Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 2.72164408058723E-7
ovarian cancer 8492 1.2478892477192E-6
glioblastoma 5572 3.56983885902374E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Heart disease 279 0.0 2.0


  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.542 0.000
glioblastoma -1.200 0.000
ovarian cancer -1.400 0.000


Accession Q9P2D3 B5MDU8 Q7Z3B2 Q9NVL7


  Ortholog (14)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (3)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
17975119 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LKVRLETAVRASQASKAKAAARQPAPAIHSAPTIKLKTSFF                                2031 - 2071

Text Mined References (14)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.