Property Summary

NCBI Gene PubMed Count 5
PubMed Score 846.90
PubTator Score 141.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

AA Sequence

MDQFGDILEGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNE      1 - 70
RNVKFPPEHPVENDVTQTVSSFSLPASSRSKKLCDVTTGLKIHVSIPNRIPKIVKEGEDDYYTDGEESSD     71 - 140
DGKKYHVKSKSAKPSTNVKKSIRKKYCKVSSSSSSSLSSSSSGSGTDCLDAGSDSHLSDSSPSSKSSKKH    141 - 210
VSGITLLSPKHKYKSGIKSTETQPSSTTPKCGHYPEESEDTVTDVSPLSTPDISPLQSFELGIANDQKVK    211 - 280
IKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLL    281 - 350
KAFLQLDKKGPQKHHFDQPSVAPGKNYSFTREEVRQIDRENQRLLKELSRQAEKPGSKSTIPRSADHPPK    351 - 420
LYHSALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTLGQYSPL    421 - 490
RASRTSSATSGLSCRSERSAVDPSSGHPRRRPKPPNVRTAWL                                491 - 532
//

Text Mined References (13)

PMID Year Title