Property Summary

NCBI Gene PubMed Count 4
Grant Count 114
R01 Count 75
Funding $10,719,501.94
PubMed Score 804.25
PubTator Score 141.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P2B7 B3KRP7 D3DP60 Q05CU1 Q4W5M4 Q8N6E7 Q9UF45
Symbols hmw
KIAA1430

Gene

AA Sequence

MDQFGDILEGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTTENYLTEKGNE      1 - 70
RNVKFPPEHPVENDVTQTVSSFSLPASSRSKKLCDVTTGLKIHVSIPNRIPKIVKEGEDDYYTDGEESSD     71 - 140
DGKKYHVKSKSAKPSTNVKKSIRKKYCKVSSSSSSSLSSSSSGSGTDCLDAGSDSHLSDSSPSSKSSKKH    141 - 210
VSGITLLSPKHKYKSGIKSTETQPSSTTPKCGHYPEESEDTVTDVSPLSTPDISPLQSFELGIANDQKVK    211 - 280
IKKQENVSQEIYEDVEDLKNNSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLL    281 - 350
KAFLQLDKKGPQKHHFDQPSVAPGKNYSFTREEVRQIDRENQRLLKELSRQAEKPGSKSTIPRSADHPPK    351 - 420
LYHSALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRARSTLGQYSPL    421 - 490
RASRTSSATSGLSCRSERSAVDPSSGHPRRRPKPPNVRTAWL                                491 - 532
//

Text Mined References (12)

PMID Year Title
24554765 2014 hemingway is required for sperm flagella assembly and ciliary motility in Drosophila.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...