Property Summary

NCBI Gene PubMed Count 22
PubMed Score 82.07
PubTator Score 23.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Mucocutaneous leishmaniasis 4 3.309 1.7

Expression

Gene RIF (4)

AA Sequence

MAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYVQATDKRKALEETMAFTTQALASVAYQVGNLAG      1 - 70
HTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPPGQKVIAPENLPPLTPYCRRP     71 - 140
LNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASATLGRPPRIPEPVHLPVVPDGRLSAASSAFS    141 - 210
LASAGSAEGVGGAPTPKGQAAPPAPPLPSSLDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDLPPP    211 - 280
PPLDGDELGLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTSQKDNELSFSEGTVICVTRRYSDGWCEGVS    281 - 350
SEGTGFFPGNYVEPSC                                                          351 - 366
//

Text Mined References (24)

PMID Year Title