Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $142,780
PubMed Score 1.41
PubTator Score 1.34

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P299
Symbols zeta2-COP

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
21746916 The knockdown of COPZ1, but not of COPZ2 encoding isoform coatomer protein complex zeta2, caused Golgi apparatus collapse, blocked autophagy, and induced apoptosis in both proliferating and nondividing tumor cells.
19167404 The solution structure of a truncated form (residues 1-149; zeta-COP149) of human zeta-COP (total 177 residues), is reported.

AA Sequence

MQRPEAWPRPHPGEGAAAAQAGGPAPPARAGEPSGLRLQEPSLYTIKAVFILDNDGRRLLAKYYDDTFPS      1 - 70
MKEQMVFEKNVFNKTSRTESEIAFFGGMTIVYKNSIDLFLYVVGSSYENELMLMSVLTCLFESLNHMLRK     71 - 140
NVEKRWLLENMDGAFLVLDEIVDGGVILESDPQQVIQKVNFRADDGGLTEQSVAQVLQSAKEQIKWSLLK    141 - 210
//

Text Mined References (9)

PMID Year Title
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
21746916 2011 Tumor-specific silencing of COPZ2 gene encoding coatomer protein complex subunit ? 2 renders tumor cells dependent on its paralogous gene COPZ1.
19167404 2009 Solution structure of human zeta-COP: direct evidences for structural similarity between COP I and clathrin-adaptor coats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14729954 2004 Novel isotypic gamma/zeta subunits reveal three coatomer complexes in mammals.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11056392 2000 Identification and characterization of novel isoforms of COP I subunits.
10982407 2000 RGS4 and RGS2 bind coatomer and inhibit COPI association with Golgi membranes and intracellular transport.
8940050 1996 In vivo assembly of coatomer, the COP-I coat precursor.