Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.81987227328049E-36
lung adenocarcinoma 2714 3.73616892774994E-19
pituitary cancer 1972 3.0820042188402E-9
lung cancer 4473 3.89954035660275E-6
medulloblastoma, large-cell 6234 5.70582548759883E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 2.05412246659149E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.18817115025108E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00410169315844508
astrocytic glioma 2241 0.0125032968917496
ependymoma 2514 0.0324400590836453
Disease Target Count Z-score Confidence
Adenoma 165 3.321 1.7

Expression

Synonym

Accession Q9P298 D3DX57 Q9P297
Symbols CLST11240
CLST11240-15

Gene

PDB

2LON  

  Ortholog (10)

AA Sequence

MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQA      1 - 70
CAVGAIMLGAVYTMYSDYVKRMAQDAGEK                                              71 - 99
//

Text Mined References (8)

PMID Year Title
22993617 2010 Analysis of differential gene expression by bead-based fiber-optic array in growth-hormone-secreting pituitary adenomas.
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
22588334 2012 Analysis of differential gene expression in plurihormonal pituitary adenomas using bead-based fiber-optic arrays.
22166531 2010 Differential gene expression by fiber-optic beadarray and pathway in adrenocorticotrophin-secreting pituitary adenomas.
21351040 2011 Analysis of differential gene expression by bead-based fiber-optic array in nonfunctioning pituitary adenomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.