Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.38
PubTator Score 4.23

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSANRRWWVPPDDEDCVSEKLLRKTRESPLVPIGLGGCLVVAAYRIYRLRSRGSTKMSIHLIHTRVAAQA      1 - 70
CAVGAIMLGAVYTMYSDYVKRMAQDAGEK                                              71 - 99
//

Text Mined References (8)

PMID Year Title
22993617 2010 Analysis of differential gene expression by bead-based fiber-optic array in growth-hormone-secreting pituitary adenomas.
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
22588334 2012 Analysis of differential gene expression in plurihormonal pituitary adenomas using bead-based fiber-optic arrays.
22166531 2010 Differential gene expression by fiber-optic beadarray and pathway in adrenocorticotrophin-secreting pituitary adenomas.
21351040 2011 Analysis of differential gene expression by bead-based fiber-optic array in nonfunctioning pituitary adenomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.