Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.37
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
26464700 It is suggested that the ALEX1 protein is associated with tumorigenesis in cervical cancer and we speculate that the ALEX1 may plays a role as an oncogene in cervical cancer.
25921134 ALEX1 is a crucial tumor suppressor gene involved in cell proliferation and apoptosis in breast cancer.
22494058 Findings suggest that overexpression of ALEX1 (armadillo repeat containing, X-linked [ARMCX]) plays a negative role in colorectal tumorigenesis.
20398052 Human Arm protein lost in epithelial cancers, on chromosome X 1 (ALEX1) gene is transcriptionally regulated by CREB and Wnt/beta-catenin signaling.

AA Sequence

MGRTREAGCVAAGVVIGAGACYCVYRLAWGRDENEKIWDEDEESTDTSEIGVETVKGAKTNAGAGSGAKL      1 - 70
QGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAP     71 - 140
SLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRAPATTWPVRRGKFNFPYKIDDILSAPDLQKV    141 - 210
LNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAEN    211 - 280
QGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQIMKL    281 - 350
IINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSRKEFSRSSLFFL    351 - 420
FKESGVCVKKIKALANHNDLVVKVKVLKVLTKL                                         421 - 453
//

Text Mined References (14)

PMID Year Title
26464700 2015 ALEX1 may be a novel biomarker for human cervical squamous cell carcinoma.
25921134 2015 ALEX1 Regulates Proliferation and Apoptosis in Breast Cancer Cells.
25416956 2014 A proteome-scale map of the human interactome network.
22569362 2012 The Eutherian Armcx genes regulate mitochondrial trafficking in neurons and interact with Miro and Trak2.
22494058 2012 ALEX1 suppresses colony formation ability of human colorectal carcinoma cell lines.
20398052 2010 Human Arm protein lost in epithelial cancers, on chromosome X 1 (ALEX1) gene is transcriptionally regulated by CREB and Wnt/beta-catenin signaling.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...