Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.83
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.400 7.8e-03
acute quadriplegic myopathy 1.159 9.2e-05
Amyotrophic lateral sclerosis 1.171 2.0e-06
atypical teratoid / rhabdoid tumor -1.400 1.4e-02
Breast cancer -1.300 1.7e-03
colon cancer -3.000 1.7e-03
cystic fibrosis 1.500 6.0e-04
dermatomyositis 1.200 6.0e-03
Duchenne muscular dystrophy 1.083 4.6e-06
intraductal papillary-mucinous adenoma (... -1.300 3.9e-03
intraductal papillary-mucinous carcinoma... -2.900 1.6e-04
intraductal papillary-mucinous neoplasm ... -3.000 1.9e-03
invasive ductal carcinoma -1.800 1.1e-02
juvenile dermatomyositis 1.102 1.2e-07
lung adenocarcinoma -1.100 2.4e-09
lung cancer -2.500 6.0e-05
malignant mesothelioma -1.800 6.9e-08
non-small cell lung cancer -1.260 4.0e-12
ovarian cancer -3.900 4.2e-11
ulcerative colitis 1.100 1.1e-03

Gene RIF (4)

AA Sequence

MGRTREAGCVAAGVVIGAGACYCVYRLAWGRDENEKIWDEDEESTDTSEIGVETVKGAKTNAGAGSGAKL      1 - 70
QGDSEVKPEVSLGLEDCPGVKEKAHSGSHSGGGLEAKAKALFNTLKEQASAKAGKGARVGTISGNRTLAP     71 - 140
SLPCPGGRGGGCHPTRSGSRAGGRASGKSKGKARSKSTRAPATTWPVRRGKFNFPYKIDDILSAPDLQKV    141 - 210
LNILERTNDPFIQEVALVTLGNNAAYSFNQNAIRELGGVPIIAKLIKTKDPIIREKTYNALNNLSVNAEN    211 - 280
QGKIKTYISQVCDDTMVCRLDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQIMKL    281 - 350
IINFTENPAMTRELVSCKVPSELISLFNKEWDREILLNILTLFENINDNIKNEGLASSRKEFSRSSLFFL    351 - 420
FKESGVCVKKIKALANHNDLVVKVKVLKVLTKL                                         421 - 453
//

Text Mined References (14)

PMID Year Title