Property Summary

Ligand Count 3
NCBI Gene PubMed Count 33
PubMed Score 19.24
PubTator Score 19.69

Knowledge Summary

Patent (23,471)

Expression

  Differential Expression (19)

Disease log2 FC p
aldosterone-producing adenoma -1.188 1.7e-02
cystic fibrosis 2.435 1.0e-05
ductal carcinoma in situ 1.600 1.6e-02
ependymoma 1.200 4.7e-02
intraductal papillary-mucinous adenoma (... 2.000 2.5e-03
intraductal papillary-mucinous carcinoma... 2.200 2.0e-03
intraductal papillary-mucinous neoplasm ... 3.000 5.0e-03
invasive ductal carcinoma 1.700 1.4e-02
lung cancer 1.400 4.9e-03
lung carcinoma -1.200 1.6e-13
malignant mesothelioma -2.400 1.0e-08
medulloblastoma, large-cell 2.300 4.5e-02
Multiple myeloma 1.372 1.7e-02
non-small cell lung cancer 1.021 1.4e-10
osteosarcoma 2.809 5.5e-03
ovarian cancer -4.400 1.4e-08
pancreatic cancer 1.300 3.3e-05
pituitary cancer 2.000 1.4e-06
Waldenstrons macroglobulinemia 1.604 5.5e-03

Gene RIF (14)

AA Sequence

MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQE      1 - 70
ITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKK     71 - 140
IHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAI    141 - 210
ELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK    211 - 280
TSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTL    281 - 350
SCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP        351 - 416
//

Text Mined References (46)

PMID Year Title