Property Summary

NCBI Gene PubMed Count 30
Grant Count 18
R01 Count 7
Funding $1,982,863.55
PubMed Score 16.06
PubTator Score 19.69

Knowledge Summary

Patent (23,471)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (12)

PMID Text
25650755 these data identify the MST4 kinase as a novel candidate to mediate human pituitary tumorigenesis in a hypoxic environment and position it as a potential therapeutic target.
25642822 Findings reveal a mechanism by which TRAF6 is regulated and highlight a role for MST4 in limiting inflammatory responses.
25550858 Our results suggest that MST4, STK25 and PDCD10 are upregulated in prostate cancer and may play roles in prostate tumorigenesis. MST4 may be a helpful marker for identifying prostate cancer.
24859810 This study describes the key role of MST4 in facilitating the epithelial-mesenchymal transition process in hepatocellular carcinoma
24374310 Mutation of this residue was sufficient to switch the phosphorylation site preference for multiple kinases, including the serine-specific kinase PAK4 and the threonine-specific kinase MST4.
23889253 In this review, the germinal center kinase III subfamily of mammalian Ste20 (sterile 20)-like group of serine/threonine protein kinases comprises Ste20-like/oxidant-stress-response kinase 1, MST3 mammalian Ste20-like kinase 3 and MST4.
23541896 CCM3 forms a stable complex with MST4 in vivo to promote cell proliferation and migration synergistically in a manner dependent on MST4 kinase activity.
22750858 crystal of the CCM3-MST4 C-terminal domain complex belonged to space group P4(1)2(1)2 or P4(3)2(1)2, with unit-cell parameters a = 69.10, b = 69.10, c = 117.57 A
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
17360971 Results show that PDCD10 modulation of ERK signaling is mediated by MST4, and that PDCD10 may be a regulatory adaptor necessary for MST4 function, suggesting a link between cerebral cavernous malformation and the ERK-MAPK cascade via PDCD10/MST4.
More...

AA Sequence

MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQE      1 - 70
ITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKK     71 - 140
IHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAI    141 - 210
ELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKK    211 - 280
TSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTL    281 - 350
SCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP        351 - 416
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25650755 2015 Mammalian Ste20-like kinase 4 promotes pituitary cell proliferation and survival under hypoxia.
25642822 2015 The kinase MST4 limits inflammatory responses through direct phosphorylation of the adaptor TRAF6.
25550858 2014 Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
24859810 2014 MST4 promotes hepatocellular carcinoma epithelial-mesenchymal transition and metastasis via activation of the p-ERK pathway.
24374310 2014 Identification of a major determinant for serine-threonine kinase phosphoacceptor specificity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23889253 2013 SOcK, MiSTs, MASK and STicKs: the GCKIII (germinal centre kinase III) kinases and their heterologous protein-protein interactions.
23541896 2013 Structural mechanism of CCM3 heterodimerization with GCKIII kinases.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...