Property Summary

NCBI Gene PubMed Count 37
Grant Count 6
R01 Count 5
Funding $616,986.75
PubMed Score 32.07
PubTator Score 25.46

Knowledge Summary

Patent (9,430)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -2.700 0.003
posterior fossa group A ependymoma -4.700 0.000
oligodendroglioma -1.900 0.013
glioblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
medulloblastoma -2.100 0.013
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -1.100 0.037
adult high grade glioma -4.600 0.000
pilocytic astrocytoma -2.600 0.000
subependymal giant cell astrocytoma -3.943 0.001
Breast cancer -3.100 0.000
ovarian cancer -1.900 0.000
pituitary cancer 1.900 0.000
psoriasis -1.800 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
26212009 E47 is a novel substrate of PAK5, and PAK5-mediated phosphorylation of E47 promotes epithelial-mesenchymal transition and metastasis of colon cancer.
26116538 miR-129 suppresses tumor cell growth and invasion by targeting PAK5 in hepatocellular carcinoma.
25632266 results suggest that the inhibition of PAK5 by RNA interference might efficiently suppress tumor development of glioma cells with PAK5 high expression.
25436453 Aurora-A induced PAK7 expression in esophageal cancer cells.
25052921 PAK7 promotes cell proliferation and tumorigenesis
24869804 PAK5 functions as an oncogenic kinase in tumor cellular regulation
24474471 Results demonstrate that PAK7 is developmentally co-expressed with another known psychosis risk gene (DISC1) suggesting a potential molecular mechanism involving aberrant synapse development and plasticity.
24062079 It inhibits glioma cell migration and invasion potentially through the PAK5-Egr1-MMP2 signaling pathway.
23877225 PAK5 is correlated to human epithelial ovarian cancer (EOC) and increased PAK5 expression promotes EOC progression.
23836671 identified three kinases with gain-of-function mutations in lung cancer, namely FGFR4, MAP3K9, and PAK5. Mutations in these kinases are activating toward the ERK pathway, and targeted depletion of the mutated kinases inhibits proliferation
More...

AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTI      1 - 70
VRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTAD     71 - 140
YTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPS    141 - 210
EYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQP    211 - 280
TMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTY    281 - 350
PRGPAKLPQSQSKSGYSSSSHQYPSGYHKATLYHHPSLQSSSQYISTASYLSSLSLSSSTYPPPSWGSSS    351 - 420
DQQPSRVSHEQFRAALQLVVSPGDPREYLANFIKIGEGSTGIVCIATEKHTGKQVAVKKMDLRKQQRREL    421 - 490
LFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCLSVLRALSYLH    491 - 560
NQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRLPYGTEVDIWSLG    561 - 630
IMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRVKDLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFL    631 - 700
KLAGPPSCIVPLMRQYRHH                                                       701 - 719
//

Text Mined References (42)

PMID Year Title
26212009 2016 PAK5-mediated E47 phosphorylation promotes epithelial-mesenchymal transition and metastasis of colon cancer.
26116538 2015 miR-129 suppresses tumor cell growth and invasion by targeting PAK5 in hepatocellular carcinoma.
25632266 2015 Efficient inhibition of human glioma development by RNA interference-mediated silencing of PAK5.
25436453 2014 P21-activated kinase 7 mediates cisplatin-resistance of esophageal squamous carcinoma cells with Aurora-A overexpression.
25052921 2014 p21-activated kinase 7 is an oncogene in human osteosarcoma.
24869804 2014 An oncogenic kinase: putting PAK5 forward.
24474471 2014 An inherited duplication at the gene p21 Protein-Activated Kinase 7 (PAK7) is a risk factor for psychosis.
24062079 2014 Downregulation of PAK5 inhibits glioma cell migration and invasion potentially through the PAK5-Egr1-MMP2 signaling pathway.
23877225 2013 The overexpression of P21-activated kinase 5 (PAK5) promotes paclitaxel-chemoresistance of epithelial ovarian cancer.
23836671 2013 Targeted genetic dependency screen facilitates identification of actionable mutations in FGFR4, MAP3K9, and PAK5 in lung cancer.
More...