Property Summary

NCBI Gene PubMed Count 13
Grant Count 10
Funding $2,471,413.2
PubMed Score 4.75
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
23201403 this study obtained evidence to show that stabilization of MAPO1 is regulated through its specific interaction with folliculin and AMPK.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18403135 The identification and characterization of a novel FNIP1 homolog FNIP2 that also interacts with FLCN and AMPK, is reported.

AA Sequence

MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFSWSCSEFDLNEIRLIVYQDCDRRGRQVLFDSKAVQ      1 - 70
KIEEVTAQKTEDVPIKISAKCCQGSSSVSSSSSSSISSHSSSGGSSHHAKEQLPKYQYTRPASDVNMLGE     71 - 140
MMFGSVAMSYKGSTLKIHYIRSPPQLMISKVFSARMGSFCGSTNNLQDSFEYINQDPNLGKLNTNQNSLG    141 - 210
PCRTGSNLAHSTPVDMPSRGQNEDRDSGIARSASLSSLLITPFPSPSSSTSSSSSYQRRWLRSQTTSLEN    211 - 280
GIIPRRSTDETFSLAEETCSSNPAMVRRKKIAISIIFSLCEKEEAQRNFQDFFFSHFPLFESHMNRLKSA    281 - 350
IEKAMISCRKIAESSLRVQFYVSRLMEALGEFRGTIWNLYSVPRIAEPVWLTMMSGTLEKNQLCQRFLKE    351 - 420
FTLLIEQINKNQFFAALLTAVLTYHLAWVPTVMPVDHPPIKAFSEKRTSQSVNMLAKTHPYNPLWAQLGD    421 - 490
LYGAIGSPVRLTRTVVVGKQKDLVQRILYVLTYFLRCSELQENQLTWSGNHGEGDQVLNGSKIITALEKG    491 - 560
EVEESEYVVITVRNEPALVPPILPPTAAERHNPWPTGFPECPEGTDSRDLGLKPDKEANRRPEQGSEACS    561 - 630
AGCLGPASDASWKPQNAFCGDEKNKEAPQDGSSRLPSCEVLGAGMKMDQQAVCELLKVEMPTRLPDRSVA    631 - 700
WPCPDRHLREKPSLEKVTFQIGSFASPESDFESRMKKMEERVKACGPSLEASEAADVAQDPQVSRSPFKP    701 - 770
GFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGL    771 - 840
YVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEGDIPRNESSDSALGDSDDEACASAML    841 - 910
DLGHGGDRTGGSLEVELPLPRSQSISTQNVRNFGRSLLAGYCPTYMPDLVLHGTGSDEKLKQCLVADLVH    911 - 980
TVHHPVLDEPIAEAVCIIADTDKWSVQVATSQRKVTDNMKLGQDVLVSSQVSSLLQSILQLYKLHLPADF    981 - 1050
CIMHLEDRLQEMYLKSKMLSEYLRGHTRVHVKELGVVLGIESNDLPLLTAIASTHSPYVAQILL         1051 - 1114
//

Text Mined References (16)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
23201403 2013 Stabilization of MAPO1 by specific binding with folliculin and AMP-activated protein kinase in O?-methylguanine-induced apoptosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21209915 2010 Inactivation of the FLCN tumor suppressor gene induces TFE3 transcriptional activity by increasing its nuclear localization.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19914239 2010 Serine 62 is a phosphorylation site in folliculin, the Birt-Hogg-Dubé gene product.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19137017 2009 A novel protein, MAPO1, that functions in apoptosis triggered by O6-methylguanine mispair in DNA.
18663353 2008 Interaction of folliculin (Birt-Hogg-Dubé gene product) with a novel Fnip1-like (FnipL/Fnip2) protein.
More...