Property Summary

NCBI Gene PubMed Count 23
Grant Count 3
R01 Count 2
Funding $467,380.56
PubMed Score 22.60
PubTator Score 16.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.310 0.000
glioblastoma 1.200 0.000
medulloblastoma 1.200 0.000
medulloblastoma, large-cell 1.400 0.000
adrenocortical carcinoma -1.102 0.000
tuberculosis -1.800 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9P275 Q05C98 Q05DD0 Q6IQ38 Q8NDM8 Q9NVC8
Symbols DUB1

Gene

Gene RIF (10)

PMID Text
25775507 USP36 is a crucial and bono fide deubiquitinating enzyme controlling c-Myc's nucleolar degradation pathway
23773437 Recently, much progress has been made in understanding the physiological functions of cytokine-inducible DUBs such as DUB-1, DUB-2, and DUB-3/USP17, in regulation of cell proliferation and apoptosis in lymphocytes. [review]
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22622177 USP36 controls selective autophagy activation in Drosophila and in human cells.
21268071 Study identified a deubiquitinating enzyme USP36 that regulates the protein stability of SOD2.
19679658 Data suggest that nucleophosmin/B23 recruits USP36 to nucleoli, thereby serving as a platform for the regulation of nucleolar protein functions through ubiquitylation/deubiquitylation.
19208757 Results suggest that by deubiquitylating various nucleolar substrate proteins including nucleophosmin/B23 and fibrillarin, USP36 plays a crucial role in regulating the structure and function of nucleoli.
18566677 USP36 is overexpressed in ovarian cancer compared to normal ovary and its transcripts were identified in ascites and serum of ovarian cancer patients
15809067 indentification of deubiquitinating enzyme activity of USP36 by analyzing its capability to cleave the ubiquitin
15254734 DUB-1 is present ubuquitously within cells and has deubiitinating enzyme activity in vivo and in vitro.

AA Sequence

MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKYVLLNPKTEGA      1 - 70
SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRVGAGLHNLGNTCFLNATIQCL     71 - 140
TYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRDLKKIARHFRFGNQEDAH    141 - 210
EFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAAN    211 - 280
IVRALELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLN    281 - 350
IRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY    351 - 420
LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPIS    421 - 490
RNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPPQHFSPRTAQGLPGTSNSN    491 - 560
SSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGNDESAGLDRRGSSSSSPEHSASSDSTKAPQTP    561 - 630
RSGAAHLCDSQETNCSTAGHSKTPPSGADSKTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLW    631 - 700
RATGNDLRPPPPSPSSDLTHPMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPG    701 - 770
TSEPRSCSSISTALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAP    771 - 840
HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQVGCVTDGHHA    841 - 910
SSRKRRRKGAEGLGEEGGLHQDPLRHSCSPMGDGDPEAMEESPRKKKKRKQETQRAVEEDGHLKCPRSAK    911 - 980
PQDAVVPESSSCAPSANGWCPGDRMGLSQAPPVSWNGERESDVVQELLKYSSDKAYGRKVLTWDGKMSAV    981 - 1050
SQDAIEDSRQARTETVVDDWDEEFDRGKEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYR   1051 - 1120
R//

Text Mined References (31)

PMID Year Title
25775507 2015 The nucleolar ubiquitin-specific protease USP36 deubiquitinates and stabilizes c-Myc.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23773437 2013 Molecular mechanisms and functions of cytokine-inducible deubiquitinating enzymes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22622177 2012 The deubiquitinating enzyme USP36 controls selective autophagy activation by ubiquitinated proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21268071 2011 Protein stability of mitochondrial superoxide dismutase SOD2 is regulated by USP36.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...