Property Summary

NCBI Gene PubMed Count 18
PubMed Score 94.58
PubTator Score 32.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
oligodendroglioma 2849 1.6064465674072E-16
osteosarcoma 7933 3.52243432851647E-6
pilocytic astrocytoma 3086 2.74403525682432E-5
ovarian cancer 8492 4.58383415009326E-5
group 4 medulloblastoma 1875 2.04577780908252E-4
adult high grade glioma 2148 0.0027604868343234
glioblastoma 5572 0.00362103390406815
astrocytic glioma 2241 0.00596738142959484
invasive ductal carcinoma 2950 0.0151400008042385
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Microphthalmia 79 0.0 4.0

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.400 0.006
glioblastoma -1.800 0.004
oligodendroglioma -1.400 0.000
osteosarcoma 3.587 0.000
adult high grade glioma -1.700 0.003
group 4 medulloblastoma -1.700 0.000
pilocytic astrocytoma -2.300 0.000
invasive ductal carcinoma -1.200 0.015
ovarian cancer -1.100 0.000

Synonym

Accession Q9P273 Q5XUL9 Q96SY2 Q9NV77 Q9NVW1 Q9NZJ2 Ten-3
Symbols ODZ3
TNM3
ten-3
Ten-m3
MCOPCB9

Gene

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Opossum OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
22766609 Null mutation in ODZ3 causes autosomal recessive microphthalmia in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSETLKAFDHDSSRLLYGNRVKDLVHRE      1 - 70
ADEFTRQGQNFTLRQLGVCEPATRRGLAFCAEMGLPHRGYSISAGSDADTENEAVMSPEHAMRLWGRGVK     71 - 140
SGRSSCLSSRSNSALTLTDTEHENKSDSENEQPASNQGQSTLQPLPPSHKQHSAQHHPSITSLNRNSLTN    141 - 210
RRNQSPAPPAALPAELQTTPESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYS    211 - 280
PPTRPLPRNTLSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFEN    281 - 350
GKVNSDTMPTNTVSLPSGDNGKLGGFTQENNTIDSGELDIGRRAIQEIPPGIFWRSQLFIDQPQFLKFNI    351 - 420
SLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRSLLETERAGRQARSVSLHEAGFIQYLDSGI    421 - 490
WHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVSGTCHCFPGFLGPDCSRAACPVLCSGNGQYS    491 - 560
KGRCLCFSGWKGTECDVPTTQCIDPQCGGRGICIMGSCACNSGYKGESCEEADCIDPGCSNHGVCIHGEC    561 - 630
HCSPGWGGSNCEILKTMCPDQCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEE    631 - 700
GWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDQNGWHCVCQPGWRG    701 - 770
AGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIISQSLQSPSQQAAKSFYDR    771 - 840
ISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVNVSFFHYPEYGYTITRQDGMFDLVANGG    841 - 910
ASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFVRPNPIIVSSPLSTFFRSSPE    911 - 980
DSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQSIIPFNLMKVHLMVAVVGRLFQKWFP    981 - 1050
ASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHH   1051 - 1120
VLDVQNGILYKGNGENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACGIDGSLYVGD   1121 - 1190
FNYVRRIFPSGNVTSVLELSSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGT   1191 - 1260
GEQCLPFDEARCGDGGKAVEATLMSPKGMAVDKNGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLT   1261 - 1330
CDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYPVGKHAVQT   1331 - 1400
TLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAK   1401 - 1470
LSAPSSLAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGD   1471 - 1540
YLYNFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTY   1541 - 1610
HGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSS   1611 - 1680
IDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWR   1681 - 1750
FRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVN   1751 - 1820
VTYSSTGQIASIQRGTTSEKVDYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLS   1821 - 1890
AITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEIL   1891 - 1960
YDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSM   1961 - 2030
QGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEIFRSLMY   2031 - 2100
WITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSNSARL   2101 - 2170
TPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSSKT   2171 - 2240
SLGQHLQFFYADLTYPTRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNG   2241 - 2310
LMLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPA   2311 - 2380
PFNLYMFRNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWDDIPPI   2381 - 2450
FGVQQQVARQAKAFLSLGKMAEVQVSRRRAGGAQSWLWFATVKSLIGKGVMLAVSQGRVQTNVLNIANED   2451 - 2520
CIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTSGRKALENGINVTVSQSTTVVNGRT   2521 - 2590
RRFADVEMQFGALALHVRYGMTLDEEKARILEQARQRALARAWAREQQRVRDGEEGARLWTEGEKRQLLS   2591 - 2660
AGKVQGYDGYYVLSVEQYPELADSANNIQFLRQSEIGRR                                  2661 - 2699
//

Text Mined References (18)

PMID Year Title
25192705 2014 No evidence of gene-calcium interactions from genome-wide analysis of colorectal cancer risk.
24859618 2014 The genetic architecture of microphthalmia, anophthalmia and coloboma.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22885689 2012 Genome-wide association study of multiplex schizophrenia pedigrees.
22766609 2012 Homozygous null mutation in ODZ3 causes microphthalmia in humans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...