Property Summary

NCBI Gene PubMed Count 11
Grant Count 5
R01 Count 3
Funding $298,965.66
PubMed Score 0.67
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
23381944 Study links hTRM9L and tRNA modifications to inhibition of tumour growth via LIN9 and HIF1-alpha-dependent mechanisms.

AA Sequence

MDHEAAQLEKQHVHNVYESTAPYFSDLQSKAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQVHTVGC      1 - 70
DYCGPLVEIARNRGCEAMVCDNLNLPFRDEGFDAIISIGVIHHFSTKQRRIRAIKEMARVLVPGGQLMIY     71 - 140
VWAMEQKNRHFEKQDVLVPWNRALCSQLFSESSQSGRKRQCGYPERGHPYHPPCSECSCSVCFKEQCGSK    141 - 210
RSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTLRKQIERVRPLKNTEVWASS    211 - 280
TVTVQPSRHSSLDFDHQEPFSTKGQSLDEEVFVESSSGKHLEWLRAPGTLKHLNGDHQGEMRRNGGGNFL    281 - 350
DSTNTGVNCVDAGNIEDDNPSASKILRRISAVDSTDFNPDDTMSVEDPQTDVLDSTAFMRYYHVFREGEL    351 - 420
CSLLKENVSELRILSSGNDHGNWCIIAEKKRGCD                                        421 - 454
//

Text Mined References (12)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23381944 2013 A human tRNA methyltransferase 9-like protein prevents tumour growth by regulating LIN9 and HIF1-?.
17903295 2007 Genetic correlates of longevity and selected age-related phenotypes: a genome-wide association study in the Framingham Study.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...