Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.27
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.000 2.6e-04
Astrocytoma, Pilocytic -2.400 1.4e-08
atypical teratoid / rhabdoid tumor -2.800 4.8e-11
Breast cancer -3.100 2.4e-21
cutaneous lupus erythematosus -1.500 2.3e-03
ependymoma -1.900 9.0e-10
glioblastoma -2.200 1.1e-11
group 4 medulloblastoma -1.300 2.3e-02
interstitial cystitis -1.600 1.2e-03
intraductal papillary-mucinous adenoma (... -1.100 4.4e-03
invasive ductal carcinoma -1.100 1.7e-02
lung cancer 1.400 9.1e-03
medulloblastoma, large-cell -2.000 8.4e-04
osteosarcoma 1.133 2.6e-03
pituitary cancer 1.400 1.1e-06
primitive neuroectodermal tumor -2.800 8.3e-06
psoriasis -2.400 7.6e-05
subependymal giant cell astrocytoma -2.006 5.2e-03

Gene RIF (2)

AA Sequence

MDHEAAQLEKQHVHNVYESTAPYFSDLQSKAWPRVRQFLQEQKPGSLIADIGCGTGKYLKVNSQVHTVGC      1 - 70
DYCGPLVEIARNRGCEAMVCDNLNLPFRDEGFDAIISIGVIHHFSTKQRRIRAIKEMARVLVPGGQLMIY     71 - 140
VWAMEQKNRHFEKQDVLVPWNRALCSQLFSESSQSGRKRQCGYPERGHPYHPPCSECSCSVCFKEQCGSK    141 - 210
RSHSVGYEPAMARTCFANISKEGEEEYGFYSTLGKSFRSWFFSRSLDESTLRKQIERVRPLKNTEVWASS    211 - 280
TVTVQPSRHSSLDFDHQEPFSTKGQSLDEEVFVESSSGKHLEWLRAPGTLKHLNGDHQGEMRRNGGGNFL    281 - 350
DSTNTGVNCVDAGNIEDDNPSASKILRRISAVDSTDFNPDDTMSVEDPQTDVLDSTAFMRYYHVFREGEL    351 - 420
CSLLKENVSELRILSSGNDHGNWCIIAEKKRGCD                                        421 - 454
//

Text Mined References (14)

PMID Year Title