Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.72
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Crohn Disease 97
Disease Target Count P-value
medulloblastoma, large-cell 6234 2.13060526114683E-6
group 4 medulloblastoma 1875 6.30637978749548E-6
osteosarcoma 7933 1.28635837315741E-4
atypical teratoid / rhabdoid tumor 4369 1.88606371813508E-4
posterior fossa group B ependymoma 1530 6.92478475856266E-4
Rheumatoid Arthritis 1171 0.00331200777646865
glioblastoma 5572 0.0124150666131981
pediatric high grade glioma 2712 0.0149538779374317
non primary Sjogren syndrome sicca 840 0.0166025052983125
spina bifida 1064 0.0345855386838441
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0

Expression

  Differential Expression (10)

Synonym

Accession Q9P270 A8K4P1 Q8N5R3
Symbols KIAA1458

Gene

PDB

3RDV  

  Ortholog (11)

Gene RIF (2)

PMID Text
21646404 Results identify SLAIN2 as a key component of microtubule plus end interaction networks.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MEDVNSNVNADQEVRKLQELVKKLEKQNEQLRSRSGAVQGAGSLGPGSPVRAGASIPSSGAASPRGFPLG      1 - 70
LSAKSGGGPGSGPRRTSSEELRDATSLLAAGEGGLLDEVEPLRPDELERLSGWEEEEESWLYSSPKKKLT     71 - 140
PMQKSVSPLVWCRQVLDYPSPDVECAKKSLIHKLDQTMSALKRQNLYNNPFNSMSYTSPYSPNASSPYSS    141 - 210
GFNSPSSTPVRPPIVKQLILPGNSGNLKSSDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQI    211 - 280
LARMQEESLRQEYAATTSRRSSGSSCNSTRRGTFSDQELDAQSLDDEDDNMHHAVYPAVNRFSPSPRNSP    281 - 350
RPSPKQSPRNSPRSRSPARGIEYSRVSPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSRT    351 - 420
SNTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFSNHGSGSPGSQE    421 - 490
ITQLTQTTSSPGPPMVQSTVSANPPSNINSATLTRPAGTTAMRSGLPRPSAPSAGGIPVPRSKLAQPVRR    491 - 560
SLPAPKTYGSMKDDSWKDGCY                                                     561 - 581
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21646404 2011 SLAIN2 links microtubule plus end-tracking proteins and controls microtubule growth in interphase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...