Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.48
PubTator Score 3.20

Knowledge Summary


No data available


  Disease Sources (5)

Disease Target Count
Fibrinogen Adverse Event 20
Disease Target Count P-value
juvenile dermatomyositis 1189 2.98013661744071E-12
psoriasis 6685 9.71498312004783E-10
acute quadriplegic myopathy 1157 3.19206999852467E-6
pancreatic cancer 2300 7.17921937650781E-4
primary pancreatic ductal adenocarcinoma 1271 0.00163232003225919
ovarian cancer 8492 0.00407404717725573
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0164501185392036
subependymal giant cell astrocytoma 2287 0.0186054747351063
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0249939044877957
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Fragile X-associated tremor/ataxia syndrome 5 4.184 2.1
Disease Target Count
Mental Retardation, Fra12a Type 1




  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17236128 Deficiency of DIP2B, a brain-expressed gene, may mediate the neurocognitive problems associated with FRA12A.

AA Sequence

DPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM                                     1541 - 1576

Text Mined References (21)

PMID Year Title
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20972440 2010 Meta-analysis of three genome-wide association studies identifies susceptibility loci for colorectal cancer at 1q41, 3q26.2, 12q13.13 and 20q13.33.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.