Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.34
PubTator Score 0.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.045 1.4e-07
adult high grade glioma -1.100 4.3e-04
ependymoma -1.100 1.4e-08
glioblastoma -1.200 7.0e-05
intraductal papillary-mucinous adenoma (... 1.400 2.0e-03
intraductal papillary-mucinous carcinoma... 1.200 1.6e-02
intraductal papillary-mucinous neoplasm ... 1.500 2.0e-02
medulloblastoma, large-cell -1.200 3.7e-05
osteosarcoma -1.432 1.5e-04
ovarian cancer -1.100 3.5e-05
Pick disease -1.900 4.9e-05

Gene RIF (1)

AA Sequence

MAAMAPGGSGSGGGVNPFLSDSDEDDDEVAATEERRAVLRLGAGSGLDPGSAGSLSPQDPVALGSSARPG      1 - 70
LPGEASAAAVALGGTGETPARLSIDAIAAQLLRDQYLLTALELHTELLESGRELPRLRDYFSNPGNFERQ     71 - 140
SGTPPGMGAPGVPGAAGVGGAGGREPSTASGGGQLNRAGSISTLDSLDFARYSDDGNRETDEKVAVLEFE    141 - 210
LRKAKETIQALRANLTKAAEHEVPLQERKNYKSSPEIQEPIKPLEKRALNFLVNEFLLKNNYKLTSITFS    211 - 280
DENDDQDFELWDDVGLNIPKPPDLLQLYRDFGNHQVTGKDLVDVASGVEEDELEALTPIISNLPPTLETP    281 - 350
QPAENSMLVQKLEDKISLLNSEKWSLMEQIRRLKSEMDFLKNEHFAIPAVCDSVQPPLDQLPHKDSEDSG    351 - 420
QHPDVNSSDKGKNTDIHLSISDEADSTIPKENSPNSFPRREREGMPPSSLSSKKTVHFDKPNRKLSPAFH    421 - 490
QALLSFCRMSADSRLGYEVSRIADSEKSVMLMLGRCLPHIVPNVLLAKREELIPLILCTACLHPEPKERD    491 - 560
QLLHILFNLIKRPDDEQRQMILTGCVAFARHVGPTRVEAELLPQCWEQINHKYPERRLLVAESCGALAPY    561 - 630
LPKEIRSSLVLSMLQQMLMEDKADLVREAVIKSLGIIMGYIDDPDKYHQGFELLLSALGDPSERVVSATH    631 - 700
QVFLPAYAAWTTELGNLQSHLILTLLNKIEKLLREGEHGLDEHKLHMYLSALQSLIPSLFALVLQNAPFS    701 - 770
SKAKLHGEVPQIEVTRFPRPMSPLQDVSTIIGSREQLAVLLQLYDYQLEQEGTTGWESLLWVVNQLLPQL    771 - 840
IEIVGKINVTSTACVHEFSRFFWRLCRTFGKIFTNTKVKPQFQEILRLSEENIDSSAGNGVLTKATVPIY    841 - 910
ATGVLTCYIQEEDRKLLVGFLEDVMTLLSLSHAPLDSLKASFVELGANPAYHELLLTVLWYGVVHTSALV    911 - 980
RCTAARMFELTLRGMSEALVDKRVAPALVTLSSDPEFSVRIATIPAFGTIMETVIQRELLERVKMQLASF    981 - 1050
LEDPQYQDQHSLHTEIIKTFGRVGPNAEPRFRDEFVIPHLHKLALVNNLQIVDSKRLDIATHLFEAYSAL   1051 - 1120
SCCFISEDLMVNHFLPGLRCLRTDMEHLSPEHEVILSSMIKECEQKVENKTVQEPQGSMSIAASLVSEDT   1121 - 1190
KTKFLNKMGQLTTSGAMLANVFQRKK                                               1191 - 1216
//

Text Mined References (14)

PMID Year Title