Property Summary

NCBI Gene PubMed Count 22
Grant Count 17
R01 Count 10
Funding $1,122,437.24
PubMed Score 28.19
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26158537 RCC2 exhibits guanine exchange factor activity, in vitro and in cells, for the small GTPase RalA. RCC2 and RalA apparently work together to contribute to the regulation of kinetochore-microtubule interactions in early mitosis.
25910952 Impaired RCC2 affects functional and clinical endpoints of colorectal cancer. High-risk patients with either MSI or MSS tumors can be identified with cost-effective routine RCC2 assays.
23442884 MiR-29c is downregulated in gastric carcinomas and regulates cell proliferation by targeting RCC2.
23388455 TD-60 is an essential regulator of cell cycle progression during interphase.
22944692 Positional proteomics analysis identifies the cleavage of human regulator of chromosome condensation 2 (RCC2) at amino acid residues 56-57 by the HIV-1 protease
22282019 a complex containing cortactin and RCC2/TD60 complex that may play a functional role in cells undergoing mitosis.
20873769 Studies indicated that DDX21, HNRNPC, and RCC2 were isolated from Ku86 multicomponent complex in response to DNA damage.
19738201 Dysregulation of Rac1 and Arf6 function by RCC2 knockdown also abolished persistent migration along fibronectin fibers, indicating a functional role for RCC2 in directional cell movement.
18849993 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12919680 Data show that TD-60 is a member of the RCC1 family and that it binds preferentially the nucleotide-free form of the small G protein Rac1.

AA Sequence

MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSSSGGGSSGDEDGLELDGAPGGGKRAA      1 - 70
RPATAGKAGGAAVVITEPEHTKERVKLEGSKCKGQLLIFGATNWDLIGRKEVPKQQAAYRNLGQNLWGPH     71 - 140
RYGCLAGVRVRTVVSGSCAAHSLLITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEGLSHEVIVSAACG    141 - 210
RNHTLALTETGSVFAFGENKMGQLGLGNQTDAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGC    211 - 280
PEYGQLGHNSDGKFIARAQRIEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVLDSQKR    281 - 350
VFSWGFGGYGRLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAVSEVGGLFFWGATNTSRESTMY    351 - 420
PKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVA    421 - 490
MGYSHSLVIARDESETEKEKIKKLPEYNPRTL                                          491 - 522
//

Text Mined References (31)

PMID Year Title
26158537 2015 TD-60 links RalA GTPase function to the CPC in mitosis.
25910952 2015 Regulator of Chromosome Condensation 2 Identifies High-Risk Patients within Both Major Phenotypes of Colorectal Cancer.
25074804 2014 Coronin-1C and RCC2 guide mesenchymal migration by trafficking Rac1 and controlling GEF exposure.
24403052 2014 Germline sequence variants in TGM3 and RGS22 confer risk of basal cell carcinoma.
23442884 2013 MiR-29c is downregulated in gastric carcinomas and regulates cell proliferation by targeting RCC2.
23388455 2013 TD-60 is required for interphase cell cycle progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22282019 2012 Mass spectrometric analysis identifies a cortactin-RCC2/TD60 interaction in mitotic cells.
More...