Property Summary

NCBI Gene PubMed Count 22
PubMed Score 31.42
PubTator Score 21.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (10)

AA Sequence

MPRKKAAAAAWEEPSSGNGTARAGPRKRGGPAGRKRERPERCSSSSGGGSSGDEDGLELDGAPGGGKRAA      1 - 70
RPATAGKAGGAAVVITEPEHTKERVKLEGSKCKGQLLIFGATNWDLIGRKEVPKQQAAYRNLGQNLWGPH     71 - 140
RYGCLAGVRVRTVVSGSCAAHSLLITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEGLSHEVIVSAACG    141 - 210
RNHTLALTETGSVFAFGENKMGQLGLGNQTDAVPSPAQIMYNGQPITKMACGAEFSMIMDCKGNLYSFGC    211 - 280
PEYGQLGHNSDGKFIARAQRIEYDCELVPRRVAIFIEKTKDGQILPVPNVVVRDVACGANHTLVLDSQKR    281 - 350
VFSWGFGGYGRLGHAEQKDEMVPRLVKLFDFPGRGASQIYAGYTCSFAVSEVGGLFFWGATNTSRESTMY    351 - 420
PKAVQDLCGWRIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVA    421 - 490
MGYSHSLVIARDESETEKEKIKKLPEYNPRTL                                          491 - 522
//

Text Mined References (31)

PMID Year Title