Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (1)

PMID Text
16714237 This KRAB-zinc finger protein serves as a moderate transcriptional factor for Rpe65 gene upregulation.

AA Sequence

MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKKNYFQKVILRR      1 - 70
YKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVKVFHKFSNSNRHTIRHTGKKS     71 - 140
FKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNETSNLSTHKRIHTGKKPYKCEECGKAFNRLS    141 - 210
HLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKP    211 - 280
YKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSS    281 - 350
TLTTHKRIHAGEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP    351 - 420
YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSS    421 - 490
ILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK                                 491 - 531
//

Text Mined References (6)

PMID Year Title
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
17567985 2007 Distinct class of putative "non-conserved" promoters in humans: comparative studies of alternative promoters of human and mouse genes.
16714237 2006 Identification of a KRAB-zinc finger protein binding to the Rpe65 gene promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.