Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.47

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.3e-03
group 4 medulloblastoma 1.500 5.3e-06
ovarian cancer 1.200 1.1e-02
pediatric high grade glioma 1.100 1.5e-02
primitive neuroectodermal tumor 1.400 7.4e-03

Gene RIF (1)

AA Sequence

MLENYRNLVFVGIAASKPDLITCLEQGKEPWNVKRHEMVAEPPVVCSYFARDLWPKQGKKNYFQKVILRR      1 - 70
YKKCGCENLQLRKYCKSMDECKVHKECYNGLNQCLTTTQNKIFQCDKYVKVFHKFSNSNRHTIRHTGKKS     71 - 140
FKCKECEKSFCMLSHLAQHKRIHSGEKPYKCKECGKAYNETSNLSTHKRIHTGKKPYKCEECGKAFNRLS    141 - 210
HLTTHKIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIHAGEKP    211 - 280
YKCEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSQLSHLTTHKRIHSGEKPYKCEECGKAFKQSS    281 - 350
TLTTHKRIHAGEKFYKCEVCSKAFSRFSHLTTHKRIHTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKP    351 - 420
YKCEECGKAFNQSSTLSKHKVIHTGEKPYKYEECGKAFNQSSHLTTHKMIHTGEKPYKCEECGKAFNNSS    421 - 490
ILNRHKMIHTGEKLYKPESCNNACDNIAKISKYKRNCAGEK                                 491 - 531
//

Text Mined References (6)

PMID Year Title