Property Summary

NCBI Gene PubMed Count 47
Grant Count 73
R01 Count 54
Funding $9,562,475.39
PubMed Score 63.06
PubTator Score 50.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous carcinoma... 1.100 0.014
Breast cancer -1.200 0.000
ovarian cancer -1.400 0.000

Synonym

Accession Q9P246 A6H8L7 B7ZVY0 Q96BF1 Q9BQH2 Q9H8R1
Symbols

Gene

PDB

2L5Y  

Gene RIF (34)

PMID Text
26033257 STIM2beta does not by itself strongly bind Orai1, it is recruited to Orai1 channels by forming heterodimers with other STIM isoforms.
25896806 These results imply that the splice variant STIM2.1 is an additional player tuning Orai1 activation in vivo.
25896806 STIM2.1 cannot activate Orai1 due to splicing in residues within the channel-activating domain (CAD). STIM2.1 confers a calcium dependent dominant-negative function on both STIM1 and STIM2 (STIM2.2). Affinity of the STIM2.1 calmodulin binding site within the CAD domain is increased compared to STIM2.2.
25587190 STIM2 enhances receptor-stimulated Ca(2) signaling by promoting recruitment of STIM1 to the endoplasmic reticulum-plasma membrane junctions.
25533457 Imin channels are regulated by STIM2, TRPC3-containing INS channels are induced by STIM1, and TRPC1-composed Imax channels are activated by both STIM1 and STIM2.
25143380 the reciprocal shift in transient receptor potential channel 1 (TRPC1) and stromal interaction molecule 2 (STIM2) contributes to Ca2+ remodeling and cancer hallmarks in colorectal carcinoma cells
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24492416 While STIM1 is a full Orai1-agonist, leucine-replacement of this crucial residue in STIM2 endows it with partial agonist properties, which may be critical for limiting Orai1 activation stemming from its enhanced sensitivity to store-depletion
24472175 STIM2 is highly expressed and controls store-operated Ca(2+) entry in human melanoma. The invasive and migratory potential of melanoma cells was reduced upon silencing of STIM2.
24044355 Binding of the lysine rich domains of STIM1 and STIM2 to phosphatidylinositol 4,5 biphosphate rich liposomes depends on their oligomerization.
More...

AA Sequence

MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPCFTEEDRFSLE      1 - 70
ALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLED     71 - 140
TLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRP    141 - 210
PHNWMKDFILTVSIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVA    211 - 280
VEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDA    281 - 350
LQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL    351 - 420
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPP    421 - 490
IVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPD    491 - 560
ILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSLNSSIGRKQSPPLSLEIYQTLSPRKISRDEV    561 - 630
SLEDSSRGDSPVTVDVSWGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSS    631 - 700
AGNDSKPVQEAPSVARISSIPHDLCHNGEKSKKPSKIKSLFKKKSK                            701 - 746
//

Text Mined References (52)

PMID Year Title
26033257 2015 Alternative splicing converts STIM2 from an activator to an inhibitor of store-operated calcium channels.
25896806 2015 A STIM2 splice variant negatively regulates store-operated calcium entry.
25587190 2015 STIM2 enhances receptor-stimulated Ca²? signaling by promoting recruitment of STIM1 to the endoplasmic reticulum-plasma membrane junctions.
25533457 2015 STIM1 and STIM2 proteins differently regulate endogenous store-operated channels in HEK293 cells.
25367360 2015 Genome-wide association study for refractive astigmatism reveals genetic co-determination with spherical equivalent refractive error: the CREAM consortium.
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
25310821 2014 A genome-wide association study identifies potential susceptibility loci for Hirschsprung disease.
25143380 2014 A reciprocal shift in transient receptor potential channel 1 (TRPC1) and stromal interaction molecule 2 (STIM2) contributes to Ca2+ remodeling and cancer hallmarks in colorectal carcinoma cells.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24492416 2014 Distinct Orai-coupling domains in STIM1 and STIM2 define the Orai-activating site.
More...