Property Summary

NCBI Gene PubMed Count 24
Grant Count 5
R01 Count 5
Funding $350,000
PubMed Score 30.74
PubTator Score 13.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P243 B7ZL15 E9PER3 Q3MIM5 Q6PJ01 Q75PJ6 Q75PJ7 Q75PJ9 Q86X64
Symbols AITD3
ZFAT1
ZNF406

Gene

PDB

2ELM   2ELN   2ELO   2ELP   2ELQ   2ELR   2ELS   2ELT   2ELU   2ELV   2RSH   2RSI   2RSJ   2RUT   2RUU   2RUV   2RUW   2RUX   2RUY   2RUZ   2RV0   2RV1   2RV2   2RV3   2RV6   2RV7  

Gene RIF (10)

PMID Text
25801860 We describe the structural features of the ZFAT ZFs, including the structural differences on the putative DNA recognition surfaces among the ZFAT ZFs, and the unique interaction mode within the tandem ZFs of ZF4 and ZF5
22894909 ZFAT is paternally expressed in the placenta (as ZFAT-AS1, a non-coding antisense RNA)but biallelic in other tissues.
22706687 ZFAT polymorphism was associated with the Hashimoto disease severity but not with its development.
20645017 These results suggest that ZFAT may have critical roles in the capillary-like network formation that is involved in vascular remodeling.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20453441 It plays a specific role in differentiation and immunologic stimulation in B and T cells to cause autoimmune thyroid disease and contains AT-hook domain and 18 C2H2-type zin finger domain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19847924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19162026 ZFAT protein is a critical regulator involved in apoptosis and cell survival for immune-related cells
15294872 Polymorphism, Single Nucleotide in ZFAT is associated with autoimmune thyroid disease

AA Sequence

METRAAENTAIFMCKCCNLFSPNQSELLSHVSEKHMEEGVNVDEIIIPLRPLSTPEPPNSSKTGDEFLVM      1 - 70
KRKRGRPKGSTKKSSTEEELAENIVSPTEDSPLAPEEGNSLPPSSLECSKCCRKFSNTRQLRKHICIIVL     71 - 140
NLGEEEGEAGNESDLELEKKCKEDDREKASKRPRSQKTEKVQKISGKEARQLSGAKKPIISVVLTAHEAI    141 - 210
PGATKIVPVEAGPPETGATNSETTSADLVPRRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVF    211 - 280
KFKHSLQAHLRIHTNEKPYKCPQCSYASAIKANLNVHLRKHTGEKFACDYCSFTCLSKGHLKVHIERVHK    281 - 350
KIKQHCRFCKKKYSDVKNLIKHIRDAHDPQDKKVKEALDELCLMTREGKRQLLYDCHICERKFKNELDRD    351 - 420
RHMLVHGDKWPFACELCGHGATKYQALELHVRKHPFVYVCAVCRKKFVSSIRLRTHIKEVHGAAQEALVF    421 - 490
TSSINQSFCLLEPGGDIQQEALGDQLQLVEEEFALQGVNALKEEACPGDTQLEEGRKEPEAPGEMPAPAV    491 - 560
HLASPQAESTALPPCELETTVVSSSDLHSQEVVSDDFLLKNDTSSAEAHAAPEKPPDMQHRSSVQTQGEV    561 - 630
ITLLLSKAQSAGSDQESHGAQSPLGEGQNMAVLSAGDPDPSRCLRSNPAEASDLLPPVAGGGDTITHQPD    631 - 700
SCKAAPEHRSGITAFMKVLNSLQKKQMNTSLCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLY    701 - 770
YCSQCHYSSITKNCLKRHVIQKHSNILLKCPTDGCDYSTPDKYKLQAHLKVHTALDKRSYSCPVCEKSFS    771 - 840
EDRLIKSHIKTNHPEVSMSTISEVLGRRVQLKGLIGKRAMKCPYCDFYFMKNGSDLQRHIWAHEGVKPFK    841 - 910
CSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGTLKSHKLLHTADGKQFKCTVCDYTAAQKPQ    911 - 980
LLRHMEQHVSFKPFRCAHCHYSCNISGSLKRHYNRKHPNEEYANVGTGELAAEVLIQQGGLKCPVCSFVY    981 - 1050
GTKWEFNRHLKNKHGLKVVEIDGDPKWETATEAPEEPSTQYLHITEAEEDVQGTQAAVAALQDLRYTSES   1051 - 1120
GDRLDPTAVNILQQIIELGAETHDATALASVVAMAPGTVTVVKQVTEEEPSSNHTVMIQETVQQASVELA   1121 - 1190
EQHHLVVSSDDVEGIETVTVYTQGGEASEFIVYVQEAMQPVEEQAVEQPAQEL                    1191 - 1243
//

Text Mined References (25)

PMID Year Title
25801860 2015 Solution structures of the DNA-binding domains of immune-related zinc-finger protein ZFAT.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
22894909 2012 A genome-wide approach reveals novel imprinted genes expressed in the human placenta.
22706687 2012 Associations between autoimmune thyroid disease prognosis and functional polymorphisms of susceptibility genes, CTLA4, PTPN22, CD40, FCRL3, and ZFAT, previously revealed in genome-wide association studies.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21998595 2011 Identification, replication, and fine-mapping of Loci associated with adult height in individuals of african ancestry.
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...