Property Summary

NCBI Gene PubMed Count 16
PubMed Score 289.26
PubTator Score 131.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.700 3.4e-05
astrocytoma -1.900 4.6e-07
Astrocytoma, Pilocytic -2.100 5.1e-03
Atopic dermatitis -1.300 1.2e-02
atypical teratoid / rhabdoid tumor -4.200 8.5e-07
Breast cancer -1.300 2.6e-02
chronic rhinosinusitis -1.916 3.4e-02
cystic fibrosis 3.523 8.9e-08
ependymoma -2.100 1.6e-04
gastric carcinoma -1.600 4.3e-02
glioblastoma -3.100 1.3e-04
group 4 medulloblastoma -4.800 1.7e-06
interstitial cystitis -2.700 1.3e-03
invasive ductal carcinoma -1.500 2.1e-02
lung carcinoma 2.200 5.6e-17
medulloblastoma, large-cell -3.200 1.6e-03
oligodendroglioma -2.100 9.5e-08
ovarian cancer -2.500 8.0e-04
primitive neuroectodermal tumor -3.100 5.3e-03
ulcerative colitis -3.300 3.2e-06

Gene RIF (4)

AA Sequence

MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDID      1 - 70
MSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQGV     71 - 140
VLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSMVTNARVLGS    141 - 210
PTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSG    211 - 280
VLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYR    281 - 350
WLKNGAALVLEERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ    351 - 420
VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANG    421 - 490
TTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSG    491 - 560
DLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVIS    561 - 630
YSIQARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVP    631 - 700
EVPPSEVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVP    701 - 770
YSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV    771 - 840
RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKKTPPSQPPGNV    841 - 910
VWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDG    911 - 980
GDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVLFLIVYVLW                          981 - 1028
//

Text Mined References (19)

PMID Year Title