Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 2
Funding $337,485.34
PubMed Score 273.03
PubTator Score 131.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -1.900 0.000
glioblastoma -4.000 0.000
oligodendroglioma -2.100 0.000
posterior fossa group A ependymoma -2.800 0.000
group 4 medulloblastoma -4.800 0.000
cystic fibrosis 3.523 0.000
atypical teratoid / rhabdoid tumor -4.200 0.000
medulloblastoma, large-cell -3.200 0.002
primitive neuroectodermal tumor -3.100 0.005
Atopic dermatitis -1.300 0.012
interstitial cystitis -4.500 0.000
adult high grade glioma -3.700 0.000
pilocytic astrocytoma -2.200 0.004
lung carcinoma 2.200 0.000
Breast cancer -1.300 0.026
gastric carcinoma -1.600 0.043
invasive ductal carcinoma -1.500 0.021
ulcerative colitis -3.400 0.000
ovarian cancer -2.500 0.001
chronic rhinosinusitis -1.916 0.034

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360857 BIG1 and BIG2 have roles in endomembrane organization
19497516 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLHCEARGNPSPHYRWQLNGSDID      1 - 70
MSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAYLENFKTKMRSTVSVREGQGV     71 - 140
VLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGHLYISKVEPSDVGNYTCVVTSMVTNARVLGS    141 - 210
PTPLVLRSDGVMGEYEPKIEVQFPETLPAAKGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSG    211 - 280
VLEIPNFQQEDAGSYECIAENSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYR    281 - 350
WLKNGAALVLEERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ    351 - 420
VQVGSLVSLDCKPRASPRALSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGTYTCMAENQFGKANG    421 - 490
TTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGALADFKKDGSHFEKVGGSSSG    491 - 560
DLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGPPENVKVDEITDTTAQLSWKEGKDNHSPVIS    561 - 630
YSIQARTPFSVGWQTVTTVPEVIDGKTHTATVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVP    631 - 700
EVPPSEVNGGGGSRSELVITWDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVP    701 - 770
YSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV    771 - 840
RYWNGGGKEESSSKMKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKKTPPSQPPGNV    841 - 910
VWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSAELVLPIKEDYIIEVKATTDG    911 - 980
GDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVLFLIVYVLW                          981 - 1028
//

Text Mined References (19)

PMID Year Title
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
22566634 2012 The genetic architecture of economic and political preferences.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360857 2010 Specific functions of BIG1 and BIG2 in endomembrane organization.
20133774 2010 The protein tyrosine phosphatases PTPRZ and PTPRG bind to distinct members of the contactin family of neural recognition molecules.
19497516 2009 Identification of a genetic variant associated with abdominal aortic aneurysms on chromosome 3p12.3 by genome wide association.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18272596 2008 Interaction of amyloid precursor protein with contactins and NgCAM in the retinotectal system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...