Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $25,525.67
PubMed Score 0.58
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Breast cancer 3,094
lung carcinoma 2,844

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.900 0.000
Breast cancer -1.100 0.000

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MADGGEREELLSPSPVSPAKRQCSWPSPQAHHPRGSPGAAGGGAGGVGSSCLVLGARPHLQPDSLLDCAA      1 - 70
KTVAEKWAYERVEERFERIPEPVQRRIVYWSFPRNEREICMYSSFQYRGGPGAGAAGGAAGASPAEEGPQ     71 - 140
PPPGAAAPAGSAPGGVAAGASPGLGAGAGAAGCGGEGLPFRRGIRLLDSGSVENVLQVGFHLSGTVTELA    141 - 210
TASEPAVTYKVAISFDRCKITSVTCGCGNKDIFYCAHVVALSLYRIRKPDQVKLRLPISETLFQMNRDQL    211 - 280
QKFIQYLITAHHTEVLPTAQKLADEILSSNSEINQVNGAPDPTAGASIDDENCWHLDEEQVKEQVKLFLS    281 - 350
QGGYCGSGKQLNSMFAKVREMLRMRDSNGARMLTLITEQFVADPRLTLWRQQGTNMTDKCRQLWDELGAL    351 - 420
WVCIILNPHCKLEEKSCWLQQLQKWSDLDVCPLEDGNYGHELPNITNALPQSAIHSPDSLSRPRRTVFTR    421 - 490
AIEGRELHWQDSHLQRIISSDVYTAPACQRESERLLFNSQGQPLWLEHVPTACARVDALRSHGYPKEALR    491 - 560
LTVAIINTLRLQQQRQLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEM    561 - 630
SDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMGLGQQRLMPEGLYAQDKVCRNEEQLLSQLQELQ    631 - 700
LDDELVQTLQKQCILLLEGGPFSGLGEVIHRESVPMHTFAKYLFSALLPHDPDLSYKLALRAMRLPVLEN    701 - 770
SASAGDTSHPHHMVSVVPSRYPRWFTLGHLESQQCELASTMLTAAKGDTLRLRTILEAIQKHIHSSSLIF    771 - 840
KLAQDAFKIATPTDSSTDSTLLNVALELGLQVMRMTLSTLNWRRREMVRWLVTCATEVGVRALVSILQSW    841 - 910
YTLFTPTEATSIVAATAVSHTTILRLSLDYPQREELASCARTLALQCAMKDPQSCALSALTLCEKDHIAF    911 - 980
EAAYQIAIDAAAGGMTHSQLFTIARYMELRGYPLRAFKLASLAMSHLNLAYNQDTHPAINDVLWACALSH    981 - 1050
SLGKNELAALIPLVVKSVHCATVLSDILRRCTVTAPGLAGIPGRRSSGKLMSTDKAPLRQLLDATINAYI   1051 - 1120
NTTHSRLTHISPRHYGEFIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLLVRERFG        1121 - 1185
//

Text Mined References (7)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.