Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.58
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.2e-37
Breast cancer 3578 1.9e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.100 1.9e-04
lung carcinoma 1.900 1.2e-37

Synonym

Accession Q9P217 Q5SXQ9
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Component (1)

Gene RIF (1)

AA Sequence

MADGGEREELLSPSPVSPAKRQCSWPSPQAHHPRGSPGAAGGGAGGVGSSCLVLGARPHLQPDSLLDCAA      1 - 70
KTVAEKWAYERVEERFERIPEPVQRRIVYWSFPRNEREICMYSSFQYRGGPGAGAAGGAAGASPAEEGPQ     71 - 140
PPPGAAAPAGSAPGGVAAGASPGLGAGAGAAGCGGEGLPFRRGIRLLDSGSVENVLQVGFHLSGTVTELA    141 - 210
TASEPAVTYKVAISFDRCKITSVTCGCGNKDIFYCAHVVALSLYRIRKPDQVKLRLPISETLFQMNRDQL    211 - 280
QKFIQYLITAHHTEVLPTAQKLADEILSSNSEINQVNGAPDPTAGASIDDENCWHLDEEQVKEQVKLFLS    281 - 350
QGGYCGSGKQLNSMFAKVREMLRMRDSNGARMLTLITEQFVADPRLTLWRQQGTNMTDKCRQLWDELGAL    351 - 420
WVCIILNPHCKLEEKSCWLQQLQKWSDLDVCPLEDGNYGHELPNITNALPQSAIHSPDSLSRPRRTVFTR    421 - 490
AIEGRELHWQDSHLQRIISSDVYTAPACQRESERLLFNSQGQPLWLEHVPTACARVDALRSHGYPKEALR    491 - 560
LTVAIINTLRLQQQRQLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEM    561 - 630
SDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMGLGQQRLMPEGLYAQDKVCRNEEQLLSQLQELQ    631 - 700
LDDELVQTLQKQCILLLEGGPFSGLGEVIHRESVPMHTFAKYLFSALLPHDPDLSYKLALRAMRLPVLEN    701 - 770
SASAGDTSHPHHMVSVVPSRYPRWFTLGHLESQQCELASTMLTAAKGDTLRLRTILEAIQKHIHSSSLIF    771 - 840
KLAQDAFKIATPTDSSTDSTLLNVALELGLQVMRMTLSTLNWRRREMVRWLVTCATEVGVRALVSILQSW    841 - 910
YTLFTPTEATSIVAATAVSHTTILRLSLDYPQREELASCARTLALQCAMKDPQSCALSALTLCEKDHIAF    911 - 980
EAAYQIAIDAAAGGMTHSQLFTIARYMELRGYPLRAFKLASLAMSHLNLAYNQDTHPAINDVLWACALSH    981 - 1050
SLGKNELAALIPLVVKSVHCATVLSDILRRCTVTAPGLAGIPGRRSSGKLMSTDKAPLRQLLDATINAYI   1051 - 1120
NTTHSRLTHISPRHYGEFIEFLSKARETFLLPQDGHLQFAQFIDNLKQIYKGKKKLMLLVRERFG        1121 - 1185
//

Text Mined References (7)

PMID Year Title