Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession Q9P215 Q5TIJ1 Q8TE07
Symbols BASS2
KRBOX2
LST003

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKA      1 - 70
LYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQ     71 - 140
FPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVE    141 - 210
YAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPI    211 - 280
TREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALR    281 - 350
RAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT    351 - 420
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNT    421 - 490
DMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISS    491 - 560
ESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAESN                         561 - 609
//

Text Mined References (17)

PMID Year Title