Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 9.56689520947736E-6
interstitial cystitis 2299 3.3883462461867E-5
breast carcinoma 1614 1.50789315676677E-4
Rheumatoid Arthritis 1171 1.57709477760309E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.12513423645037E-4
Down syndrome 548 3.51528200417423E-4
invasive ductal carcinoma 2950 0.00217657633940182
group 3 medulloblastoma 2254 0.00238807809831692
ovarian cancer 8492 0.00329357298189643
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00351549354612545
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00846714392548078
subependymal giant cell astrocytoma 2287 0.0172396452038681
medulloblastoma, large-cell 6234 0.0324632193410106

Expression

Synonym

Accession Q9P215 Q5TIJ1 Q8TE07
Symbols BASS2
KRBOX2
LST003

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (2)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKA      1 - 70
LYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQ     71 - 140
FPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVE    141 - 210
YAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPI    211 - 280
TREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALR    281 - 350
RAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT    351 - 420
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNT    421 - 490
DMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISS    491 - 560
ESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAESN                         561 - 609
//

Text Mined References (16)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...