Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
19536175 Observational study of gene-disease association. (HuGE Navigator)
19064610 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFDEVAIYFSDEEWEVLTEQQKA      1 - 70
LYREVMRMNYETVLSLEFPFPKPDMITRLEGEEESQNSDEWQLQGGTSAENEESDVKPPDWPNPMNATSQ     71 - 140
FPQPQHFDSFGLRLPRDITELPEWSEGYPFYMAMGFPGYDLSADDIAGKFQFSRGMRRSYDAGFKLMVVE    141 - 210
YAESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPI    211 - 280
TREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALR    281 - 350
RAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGT    351 - 420
YIPPGKFPSGMEIRCHRYGWMTEDLMQDWLEVVWRRRTGAVPKQRGMLILNGFRGHATDSVKNSMESMNT    421 - 490
DMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPTGNAKKPPLGLFLEWVMVAWNSISS    491 - 560
ESIVQGFKKCHISSNLEEEDDVLWEIESELPGGGEPPKDCDTESMAESN                         561 - 609
//

Text Mined References (16)

PMID Year Title
25456346 2015 Genomic predictors of combat stress vulnerability and resilience in U.S. Marines: A genome-wide association study across multiple ancestries implicates PRTFDC1 as a potential PTSD gene.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21269460 2011 Initial characterization of the human central proteome.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19064610 2009 Pre-B-cell leukemia homeobox 1 (PBX1) shows functional and possible genetic association with bone mineral density variation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...