Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.33
PubTator Score 8.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Alzheimer's disease 1.200 1.6e-02
atypical teratoid / rhabdoid tumor 1.900 9.2e-06
gastric cancer 1.200 1.3e-04
glioblastoma 1.500 7.6e-05
group 3 medulloblastoma 1.300 6.6e-03
juvenile dermatomyositis 1.070 1.1e-11
malignant mesothelioma -1.600 4.8e-07
medulloblastoma, large-cell 1.700 4.3e-04
osteosarcoma -2.025 1.0e-06
ovarian cancer -1.600 2.3e-06
Pick disease 1.900 8.7e-07
primitive neuroectodermal tumor 1.200 2.4e-03
Rheumatoid arthritis 1.900 9.3e-03
spina bifida -1.072 2.8e-02

Gene RIF (4)

AA Sequence

MGANASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKF      1 - 70
IKRRKSNRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLYEYKY     71 - 140
CTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFSALLHYLYTGEFGME    141 - 210
DSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAV    211 - 280
ISARSPFFRNLLQRRIRTGEEITDRTLRTPTRIILDESIIPKKYATVILHCMYTDVVDLSVLHCSPSVGS    281 - 350
LSEVQALVAGKPNMTRAEEAMELYHIALFLEFNMLAQGCEDIIAESISLDTLIAILKWSSHPYGSKWVHR    351 - 420
QALHFLCEEFSQVMTSDVFYELSKDHLLTAIQSDYLQASEQDILKYLIKWGEHQLMKRIADREPNLLSGT    421 - 490
AHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPINSEVLSDAMKRGLISTPPSDMLPTTEGGKSNA    491 - 560
WLRQKNAGIYVRPRLFSPYVEEAKSVLDEMMVEQTDLVRLRMVRMSNVPDTLYMVNNAVPQCCHMISHQQ    561 - 630
ISSNQSSPPSVVANEIPVPRLLIMKDMVRRLQELRHTEQVQRAYALNCGEGATVSYEIQIRVLREFGLAD    631 - 700
AAAELLQNPHKFFPDERFGDESPLLTMRQPGRCRVNSTPPAETMFTDLDSFVAFHPPLPPPPPPYHPPAT    701 - 770
PIHNQLKAGWKQRPPSQHPSRSFSYPCNHSLFHSRTAPKAGPPPVYLPSVKAAPPDCTSTAGLGRQTVAA    771 - 840
AAATTTSTATAAAAAASEKQVRTQPVLNDLMPDIAVGVSTLSLKDRRLPELAVDTELSQSVSEAGPGPPQ    841 - 910
HLSCIPQRHTHTSRKKHTLEQKTDTRENPQEYPDFYDFSNAACRPSTPALSRRTPSPSQGGYFGPDLYSH    911 - 980
NKASPSGLKSAYLPGQTSPKKQEEARREYPLSPDGHLHRQKNEPIHLDVVEQPPQRSDFPLAAPENASTG    981 - 1050
PAHVRGRTAVETDLTFGLTPNRPSLSACSSEAPEERSGRRLADSESLGHGAQRNTDLEREDSISRGRRSP   1051 - 1120
SKPDFLYKKSAL                                                             1121 - 1132
//

Text Mined References (13)

PMID Year Title