Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
Funding $1,090,719.15
PubMed Score 14.05
PubTator Score 8.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.009
gastric cancer 1.200 0.000
malignant mesothelioma -1.600 0.000
osteosarcoma 2.745 0.000
group 3 medulloblastoma 1.300 0.007
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.200 0.002
juvenile dermatomyositis 1.070 0.000
spina bifida -1.072 0.028
Alzheimer's disease 1.200 0.016
Pick disease 1.900 0.000
ovarian cancer -1.600 0.000

Gene RIF (2)

PMID Text
25253020 Btbd7 contributes to reduced expression of E-cadherin and may be a promising cancer marker in non-small cell lung cancer.
23325674 Cox regression analysis revealed that high BTBD7 expression integrated with high microvessel density was a powerful independent predictive factor of hepatocellular carcinoma clinical outcome.

AA Sequence

MGANASNYPHSCSPRVGGNSQAQQTFIGTSSYSQQGYGCESKLYSLDHGHEKPQDKKKRTSGLATLKKKF      1 - 70
IKRRKSNRSADHAKQMRELLSGWDVRDVNALVEEYEGTSALKELSLQASLARPEARTLQKDMADLYEYKY     71 - 140
CTDVDLIFQETCFPVHRAILAARCPFFKTLLSSSPEYGAEIIMDINTAGIDMPMFSALLHYLYTGEFGME    141 - 210
DSRFQNVDILVQLSEEFGTPNSLDVDMRGLFDYMCYYDVVLSFSSDSELVEAFGGNQNCLDEELKAHKAV    211 - 280
ISARSPFFRNLLQRRIRTGEEITDRTLRTPTRIILDESIIPKKYATVILHCMYTDVVDLSVLHCSPSVGS    281 - 350
LSEVQALVAGKPNMTRAEEAMELYHIALFLEFNMLAQGCEDIIAESISLDTLIAILKWSSHPYGSKWVHR    351 - 420
QALHFLCEEFSQVMTSDVFYELSKDHLLTAIQSDYLQASEQDILKYLIKWGEHQLMKRIADREPNLLSGT    421 - 490
AHSVNKRGVKRRDLDMEELREILSSLLPFVRIEHILPINSEVLSDAMKRGLISTPPSDMLPTTEGGKSNA    491 - 560
WLRQKNAGIYVRPRLFSPYVEEAKSVLDEMMVEQTDLVRLRMVRMSNVPDTLYMVNNAVPQCCHMISHQQ    561 - 630
ISSNQSSPPSVVANEIPVPRLLIMKDMVRRLQELRHTEQVQRAYALNCGEGATVSYEIQIRVLREFGLAD    631 - 700
AAAELLQNPHKFFPDERFGDESPLLTMRQPGRCRVNSTPPAETMFTDLDSFVAFHPPLPPPPPPYHPPAT    701 - 770
PIHNQLKAGWKQRPPSQHPSRSFSYPCNHSLFHSRTAPKAGPPPVYLPSVKAAPPDCTSTAGLGRQTVAA    771 - 840
AAATTTSTATAAAAAASEKQVRTQPVLNDLMPDIAVGVSTLSLKDRRLPELAVDTELSQSVSEAGPGPPQ    841 - 910
HLSCIPQRHTHTSRKKHTLEQKTDTRENPQEYPDFYDFSNAACRPSTPALSRRTPSPSQGGYFGPDLYSH    911 - 980
NKASPSGLKSAYLPGQTSPKKQEEARREYPLSPDGHLHRQKNEPIHLDVVEQPPQRSDFPLAAPENASTG    981 - 1050
PAHVRGRTAVETDLTFGLTPNRPSLSACSSEAPEERSGRRLADSESLGHGAQRNTDLEREDSISRGRRSP   1051 - 1120
SKPDFLYKKSAL                                                             1121 - 1132
//

Text Mined References (11)

PMID Year Title
25253020 2014 Btbd7 contributes to reduced E-cadherin expression and predicts poor prognosis in non-small cell lung cancer.
23325674 2013 BTB/POZ domain-containing protein 7: epithelial-mesenchymal transition promoter and prognostic biomarker of hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11527404 2001 FUP1, a gene associated with hepatocellular carcinoma, stimulates NIH3T3 cell proliferation and tumor formation in nude mice.
More...