Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.34
PubTator Score 4.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 7.85115911875382E-22
malignant mesothelioma 3163 7.64094185592316E-6
psoriasis 6685 1.78833161533693E-4
inflammatory breast cancer 404 2.2644969995012E-4
Rheumatoid Arthritis 1171 0.0141198660552523
Disease Target Count Z-score Confidence
Panic disorder 55 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.014
malignant mesothelioma -1.100 0.000
psoriasis -1.900 0.000
non-small cell lung cancer -1.083 0.000
inflammatory breast cancer -1.200 0.000

Synonym

Accession Q9P1Z2 B3KVA8 Q6FI59 Q71RC3 Q86WF8 Q96JU3 Q9H090
Symbols Cocoa
PP13275
calphoglin

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GWAS Trait (1)

Gene RIF (6)

PMID Text
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165232 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of calcium binding and coiled-coil domain 1 (CALCOCO1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16931570 The N terminus of CoCoA contains another activation domain , which is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CoCoA and beta-catenin.
16344550 CoCoA uses different combinations of functional domains in its synergistic coactivator function with beta-catenin or GRIP1
15522220 Results report a novel human protein, calphoglin, which activates inorganic pyrophosphatase (IPP) and enhances phosphoglucomutase activity through the activated IPP.

AA Sequence

MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVP      1 - 70
ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEEADGGSDIL     71 - 140
LVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHG    141 - 210
EITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKE    211 - 280
QSEAELQVAQQENHHLNLDLKEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQE    281 - 350
LAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE    351 - 420
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQ    421 - 490
EEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERGDP    491 - 560
GSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLLLPELGSAFYD    561 - 630
MASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE             631 - 691
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
24245781 2014 CCAR1/CoCoA pair-mediated recruitment of the Mediator defines a novel pathway for GATA1 function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19165232 2009 Genome-wide association study of panic disorder in the Japanese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16931570 2006 Role of the N-terminal activation domain of the coiled-coil coactivator in mediating transcriptional activation by beta-catenin.
16717280 2006 Downstream signaling mechanism of the C-terminal activation domain of transcriptional coactivator CoCoA.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...