Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.34
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -1.300 0.014
malignant mesothelioma -1.100 0.000
psoriasis -1.900 0.000
non-small cell lung cancer -1.083 0.000
inflammatory breast cancer -1.200 0.000

Synonym

Accession Q9P1Z2 B3KVA8 Q6FI59 Q71RC3 Q86WF8 Q96JU3 Q9H090
Symbols Cocoa
PP13275
calphoglin

Gene

Gene RIF (6)

PMID Text
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165232 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of calcium binding and coiled-coil domain 1 (CALCOCO1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16931570 The N terminus of CoCoA contains another activation domain , which is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CoCoA and beta-catenin.
16344550 CoCoA uses different combinations of functional domains in its synergistic coactivator function with beta-catenin or GRIP1
15522220 Results report a novel human protein, calphoglin, which activates inorganic pyrophosphatase (IPP) and enhances phosphoglucomutase activity through the activated IPP.

AA Sequence

MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRDYHTFVWSSVP      1 - 70
ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFREPRPMDELVTLEEADGGSDIL     71 - 140
LVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSRVQELERALATARQEHTELMEQYKGISRSHG    141 - 210
EITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKE    211 - 280
QSEAELQVAQQENHHLNLDLKEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQE    281 - 350
LAASSQQKATLLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE    351 - 420
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALRVLQKEKEQLQ    421 - 490
EEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSEDESPEDMRLPPYGLCERGDP    491 - 560
GSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAEDEKSVLMAAVQSGGEEANLLLPELGSAFYD    561 - 630
MASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE             631 - 691
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25343990 2015 Genome-wide association study of selenium concentrations.
24245781 2014 CCAR1/CoCoA pair-mediated recruitment of the Mediator defines a novel pathway for GATA1 function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19183483 2009 Screening and association testing of common coding variation in steroid hormone receptor co-activator and co-repressor genes in relation to breast cancer risk: the Multiethnic Cohort.
19165232 2009 Genome-wide association study of panic disorder in the Japanese population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16931570 2006 Role of the N-terminal activation domain of the coiled-coil coactivator in mediating transcriptional activation by beta-catenin.
16717280 2006 Downstream signaling mechanism of the C-terminal activation domain of transcriptional coactivator CoCoA.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...