Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.29
PubTator Score 7.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -2.228 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.600 0.001
medulloblastoma -1.400 0.002
medulloblastoma, large-cell -3.100 0.000
non-small cell lung cancer -1.071 0.000
adult high grade glioma -1.300 0.003
lung adenocarcinoma -1.200 0.000
invasive ductal carcinoma -1.600 0.000
ovarian cancer -2.000 0.000
Breast cancer -1.600 0.000

Synonym

Accession Q9P1Z0 B3KVL6 Q7Z697 Q86XJ4 Q8N4V8
Symbols ZNF903
KAISO-L1

Gene

Gene RIF (6)

PMID Text
25499219 Thus, EZH2 is reciprocally regulated by a novel signaling network consisting of Sp proteins, oncogenic miRs and ZBTB4, and modulation of this gene network is a novel therapeutic approach for treatment of breast cancer and possibly other cancers.
21765466 ZBTB4 functions as a novel tumor-suppressor gene with prognostic significance for breast cancer survival
20403812 the human zinc-finger protein ZBTB4 binds methylated DNA in a sequence-specific manner.
19448668 Results show that overexpressing HIPK2 causes the degradation of ZBTB4, whereas overexpressing a kinase-deficient mutant of HIPK2 has no effect.
18451802 These data suggest that Zbtb4 is a critical determinant of the cellular response to p53 activation and reinforce the notion that p21Cip1 can provide an essential survival signal in cells with activated p53.
16354688 ZBTB4 binds methylated methylated CpGs in vitro and in vivo and represses transcrption.

AA Sequence

MPPPAEVTDPSHAPAVLRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAPLPLPPA      1 - 70
TGGAAPNPATTTAASSSSSSSSSSSSSSSSASSSSSSSSSSPPPASPPASSPPRVLELPGVPAAAFSDVL     71 - 140
NFIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGEGGDAWVPPTPAPMATSQPEEDSFGPGPRPA    141 - 210
GEWEGDRAEAQAPDLQCSLPRRPLPCPQCGKSFIHPKRLQTHEAQCRRGASTRGSTGLGAGGAGPGGPAG    211 - 280
VDASALPPPVGFRGGPEHVVKVVGGHVLYVCAACERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAE    281 - 350
YRTKHEVWHTGERRYQCIFCWETFVTYYNLKTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLLPM    351 - 420
RAAKRPYKTYSQGAPEAPLSPTLNTPAPVAMPASPPPGPPPAPEPGPPPSVITFAHPAPSVIVHGGSSSG    421 - 490
GGGSGTASTGGSQAASVITYTAPPRPPKKREYPPPPPEPAATPTSPATAVSPATAAGPAMATTTEEAKGR    491 - 560
NPRAGRTLTYTAKPVGGIGGGGGPPTGAGRGPSQLQAPPPLCQITVRIGEEAIVKRRISETDLRPGELSG    561 - 630
EEMEESEEDEEEEDEEEEEEDEEESKAGGEDQLWRPYYSYKPKRKAGAAGGASVGGSGLPRGRRPPRWRQ    631 - 700
KLERRSWEETPAAESPAGRARTERRHRCGDCAQTFTTLRKLRKHQEAHGGGSHSSRAGRRPSTRFTCPHC    701 - 770
AKVCKTAAALSRHGQRHAAERPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEE    771 - 840
ASETASLQDPIISGGEEPPVVASGGSYVYPPVQEFPLALIGGGREPGGGRGKSGSEGPVGAGEGDRMEGI    841 - 910
GAAKVTFYPEPYPLVYGPQLLAAYPYNFSNLAALPVALNMVLPDEKGAGALPFLPGVFGYAVNPQAAPPA    911 - 980
PPTPPPPTLPPPIPPKGEGERAGVERTQKGDVG                                         981 - 1013
//

Text Mined References (18)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25499219 2014 The transcriptional repressor ZBTB4 regulates EZH2 through a MicroRNA-ZBTB4-specificity protein signaling axis.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23251453 2012 Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21765466 2012 Identification of oncogenic microRNA-17-92/ZBTB4/specificity protein axis in breast cancer.
20403812 2010 Sequence-specific recognition of methylated DNA by human zinc-finger proteins.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19448668 2009 The human protein kinase HIPK2 phosphorylates and downregulates the methyl-binding transcription factor ZBTB4.
18451802 2008 Zbtb4 represses transcription of P21CIP1 and controls the cellular response to p53 activation.
More...