Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.56
PubTator Score 7.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 2.8e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-06
Breast cancer -1.600 3.0e-09
glioblastoma -1.600 6.0e-04
invasive ductal carcinoma -1.600 1.2e-04
lung adenocarcinoma -1.200 3.0e-11
medulloblastoma -1.400 2.1e-03
medulloblastoma, large-cell -3.100 2.3e-04
non-small cell lung cancer -1.071 5.7e-17
osteosarcoma -2.228 4.3e-04
ovarian cancer -2.000 8.8e-08

Gene RIF (7)

AA Sequence

MPPPAEVTDPSHAPAVLRQLNEQRLRGLFCDVTLIAGDTKFPAHRSVLAASSPFFREALLTSAPLPLPPA      1 - 70
TGGAAPNPATTTAASSSSSSSSSSSSSSSSASSSSSSSSSSPPPASPPASSPPRVLELPGVPAAAFSDVL     71 - 140
NFIYSARLALPGGGGDGAAVAEIGALGRRLGISRLQGLGEGGDAWVPPTPAPMATSQPEEDSFGPGPRPA    141 - 210
GEWEGDRAEAQAPDLQCSLPRRPLPCPQCGKSFIHPKRLQTHEAQCRRGASTRGSTGLGAGGAGPGGPAG    211 - 280
VDASALPPPVGFRGGPEHVVKVVGGHVLYVCAACERSYVTLSSLKRHSNVHSWRRKYPCRYCEKVFALAE    281 - 350
YRTKHEVWHTGERRYQCIFCWETFVTYYNLKTHQRAFHGISPGLLASEKTPNGGYKPKLNTLKLYRLLPM    351 - 420
RAAKRPYKTYSQGAPEAPLSPTLNTPAPVAMPASPPPGPPPAPEPGPPPSVITFAHPAPSVIVHGGSSSG    421 - 490
GGGSGTASTGGSQAASVITYTAPPRPPKKREYPPPPPEPAATPTSPATAVSPATAAGPAMATTTEEAKGR    491 - 560
NPRAGRTLTYTAKPVGGIGGGGGPPTGAGRGPSQLQAPPPLCQITVRIGEEAIVKRRISETDLRPGELSG    561 - 630
EEMEESEEDEEEEDEEEEEEDEEESKAGGEDQLWRPYYSYKPKRKAGAAGGASVGGSGLPRGRRPPRWRQ    631 - 700
KLERRSWEETPAAESPAGRARTERRHRCGDCAQTFTTLRKLRKHQEAHGGGSHSSRAGRRPSTRFTCPHC    701 - 770
AKVCKTAAALSRHGQRHAAERPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEE    771 - 840
ASETASLQDPIISGGEEPPVVASGGSYVYPPVQEFPLALIGGGREPGGGRGKSGSEGPVGAGEGDRMEGI    841 - 910
GAAKVTFYPEPYPLVYGPQLLAAYPYNFSNLAALPVALNMVLPDEKGAGALPFLPGVFGYAVNPQAAPPA    911 - 980
PPTPPPPTLPPPIPPKGEGERAGVERTQKGDVG                                         981 - 1013
//

Text Mined References (20)

PMID Year Title