Property Summary

Ligand Count 562
NCBI Gene PubMed Count 49
PubMed Score 187.28
PubTator Score 118.81

Knowledge Summary

Patent (13,601)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Leukemia, Myeloid, Acute 105 0.0 0.0
Disease Target Count
Leukemia, Myelocytic, Acute 120
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.772 1.9
Disease Target Count Z-score Confidence
Kabuki syndrome 27 3.276 1.6

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 2.2e-02
interstitial cystitis 2.000 4.6e-04
lung adenocarcinoma 1.200 3.5e-08
lung cancer -1.900 2.4e-04
osteosarcoma -3.145 2.4e-08
pancreatic cancer 1.400 1.3e-02
pancreatic carcinoma 1.400 1.3e-02
periodontitis 1.300 8.4e-25
psoriasis -1.200 6.3e-03
ulcerative colitis 2.100 2.1e-05

Gene RIF (42)

AA Sequence

MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG      1 - 70
WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS     71 - 140
RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS    141 - 210
RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI    211 - 280
LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP                                           281 - 311
//

Text Mined References (52)

PMID Year Title