Property Summary

NCBI Gene PubMed Count 43
Grant Count 12
R01 Count 7
Funding $457,075.13
PubMed Score 178.18
PubTator Score 118.81

Knowledge Summary

Patent (13,601)

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.400 0.013
cutaneous lupus erythematosus 2.000 0.022
psoriasis -1.200 0.006
osteosarcoma -3.145 0.000
periodontitis 1.300 0.000
lung cancer -1.900 0.000
interstitial cystitis 2.500 0.000
lung adenocarcinoma 1.200 0.000
pancreatic carcinoma 1.400 0.013
ulcerative colitis 2.100 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (36)

PMID Text
26643319 PIM2 gene knockdown enhances the anti-proliferative effect of AZD1208 in non-Hodgkin lymphoma cell line.
26551340 A high percentage of urothelial carcinomas express Pim kinases. Pim expression differs in NILG, NIHG, and IHG lesions.
26500282 We show that Pim2 inhibitors and proteasome inhibitors, such as bortezomib, have additive effects to inhibit the growth of myeloma cells, suggesting that Pim2 could be an interesting target for the treatment of multiple myeloma.
26078709 Our findings suggest that Pim-2-mediated aerobic glycolysis is critical for monitoring Warburg effect in colorectal tumor cells, highlighting Pim-2 as a potential metabolic target for colorectal tumor therapy.
26064888 our findings will help to uncover novel signaling pathways between inflammations and oxidative stress in rheumatoid arthritis development and imply that Pim-2/mTORC1 pathway may be critical for the initiation of inflammatory reactions.
25854938 Persistent activation of STAT3 by PIM2-driven positive feedback loop for epithelial-mesenchymal transition in breast cancer.
25238262 Data demonstrate the role of PIM kinases in driving myeloid leukemia, and as candidate molecules for therapy against human malignancies.
24799066 Blocking the activities of PIM kinases(PIM1, PIM2 and PIM3) could prevent pancreatic cancer development. PIM kinases(PIM1, PIM2 and PIM3) may be a novel target for cancer therapy
24505470 HIF-1A induced PIM2 expression in HepG2 cells via binding to the hypoxia-responsive elements (HREs) of the PIM2 promoter.
24142698 PIM2 could directly phosphorylate PKM2 on the Thr-454 residue, resulting in an increase of PKM2 protein levels. Compared with wild type, PKM2 with the phosphorylation-defective mutation displayed a reduced effect on glycolysis.
More...

AA Sequence

MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLG      1 - 70
WSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPLPAQDLFDYITEKGPLGEGPS     71 - 140
RCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWIS    141 - 210
RHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEI    211 - 280
LLDPWMQTPAEDVPLNPSKGGPAPLAWSLLP                                           281 - 311
//

Text Mined References (46)

PMID Year Title
26643319 2015 Loss of PIM2 enhances the anti-proliferative effect of the pan-PIM kinase inhibitor AZD1208 in non-Hodgkin lymphomas.
26551340 Patterns and Significance of PIM Kinases in Urothelial Carcinoma.
26500282 2015 Control of Pim2 kinase stability and expression in transformed human haematopoietic cells.
26078709 2015 Pim-2 Modulates Aerobic Glycolysis and Energy Production during the Development of Colorectal Tumors.
26064888 2015 Pim-2/mTORC1 Pathway Shapes Inflammatory Capacity in Rheumatoid Arthritis Synovial Cells Exposed to Lipid Peroxidations.
25854938 2015 Persistent activation of STAT3 by PIM2-driven positive feedback loop for epithelial-mesenchymal transition in breast cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25238262 2014 The PIM family of oncoproteins: small kinases with huge implications in myeloid leukemogenesis and as therapeutic targets.
24799066 2014 PIM kinases: an overview in tumors and recent advances in pancreatic cancer.
24505470 2014 A regulatory feedback loop between HIF-1? and PIM2 in HepG2 cells.
More...