Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.80
PubTator Score 6.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.300 2.6e-04
atypical teratoid / rhabdoid tumor 1.200 1.7e-03
cutaneous lupus erythematosus 1.900 9.2e-03
diabetes mellitus 1.300 2.1e-03
interstitial cystitis 1.800 1.0e-03
invasive ductal carcinoma 1.200 2.2e-02
medulloblastoma, large-cell 1.600 2.3e-04
osteosarcoma -3.278 3.7e-08
ovarian cancer 1.300 1.1e-09
psoriasis 1.700 4.1e-49
tuberculosis 1.900 1.1e-05

Gene RIF (5)

AA Sequence

MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGV      1 - 70
GPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEM     71 - 140
ALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPTGQSVAYSIRST    141 - 210
ARVVLDPWDVRSQVICEVAHVTLQGDPLRGTANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQS    211 - 280
LQLTWSENGNVCQRETASTLTENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVH    281 - 350
QKDQSSDATPGPASSLTALLLIAVLLGPIYVPWKQKT                                     351 - 387
//

Text Mined References (18)

PMID Year Title