Property Summary

NCBI Gene PubMed Count 6
PubMed Score 88.61
PubTator Score 38.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.10968522299324E-65
psoriasis 6685 2.88083083065535E-57
non-small cell lung carcinoma 413 9.38138489461183E-13
atypical teratoid/rhabdoid tumor 1095 8.11030701452593E-11
posterior fossa group A ependymoma 1511 1.43024236988614E-10
glioblastoma 5572 8.20153544555189E-9
pediatric high grade glioma 2712 3.35238421001627E-7
adrenocortical carcinoma 1427 0.00732554135534983

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group A ependymoma -1.500 0.000
glioblastoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.900 0.000
adrenocortical carcinoma 1.067 0.007
pediatric high grade glioma -1.800 0.000
lung carcinoma 4.500 0.000
non-small cell lung carcinoma 1.100 0.000
psoriasis -2.900 0.000

Synonym

Accession Q9P1W3 B2RN22 B3KWJ5 Q86TS3 Q86TS4 Q9NSQ4 Q9P1W1
Symbols CSC1
hsCSC1
C14orf171

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSASPDDLSTGGRLQNMTVDECFQSRNTVLQGQPFGGVPTVLCLNIALWVLVLVVYSFLRKAAWDYGRLA      1 - 70
LLIHNDSLTSLIYGEQSEKTSPSETSLEMERRDKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLI     71 - 140
IFVLIICIPSLGIILPINYTGSVLDWSSHFARTTIVNVSTESKLLWLHSLLSFFYFITNFMFMAHHCLGF    141 - 210
APRNSQKVTRTLMITYVPKDIEDPELIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYT    211 - 280
AKAKKTGKVMIRIHPCARLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDS    281 - 350
RMAKRVRKDYKYVQCGVQPQQSSVTTIVKSYYWRVTMAPHPKDIIWKHLSVRRFFWWARFIAINTFLFFL    351 - 420
FFFLTTPAIIMNTIDMYNVTRPIEKLQNPIVTQFFPSVMLWGFTVILPLIVYFSAFLEAHWTRSSQNLVM    421 - 490
VHKCYIFLVFMVVILPSMGLTSLDVFLRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVITAALLGTGME    491 - 560
LLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYSITCPIIVPFGLLYLCM    561 - 630
KHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFAPLLGLFWMLFFSILRLGSLHAITIFSLSTLLIAMVIA    631 - 700
FVGIFLGKLRMVADYEPEEEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMNN    701 - 770
QPEEGEEESGLRGFARELDSAQFQEGLELEGQNQYH                                      771 - 806
//

Text Mined References (8)

PMID Year Title
24503647 2014 DUF221 proteins are a family of osmosensitive calcium-permeable cation channels conserved across eukaryotes.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.