Property Summary

NCBI Gene PubMed Count 7
PubMed Score 89.43
PubTator Score 38.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
adrenocortical carcinoma 1.067 7.3e-03
adult high grade glioma -1.600 3.8e-05
atypical teratoid / rhabdoid tumor -1.600 4.6e-08
ependymoma -1.400 2.8e-07
glioblastoma -1.600 8.2e-09
lung carcinoma 4.500 2.1e-65
non-small cell lung carcinoma 1.100 9.4e-13
psoriasis -2.900 2.9e-57

Gene RIF (1)

AA Sequence

MSASPDDLSTGGRLQNMTVDECFQSRNTVLQGQPFGGVPTVLCLNIALWVLVLVVYSFLRKAAWDYGRLA      1 - 70
LLIHNDSLTSLIYGEQSEKTSPSETSLEMERRDKGFCSWFFNSITMKDEDLINKCGDDARIYIVFQYHLI     71 - 140
IFVLIICIPSLGIILPINYTGSVLDWSSHFARTTIVNVSTESKLLWLHSLLSFFYFITNFMFMAHHCLGF    141 - 210
APRNSQKVTRTLMITYVPKDIEDPELIIKHFHEAYPGSVVTRVHFCYDVRNLIDLDDQRRHAMRGRLFYT    211 - 280
AKAKKTGKVMIRIHPCARLCFCKCWTCFKEVDAEQYYSELEEQLTDEFNAELNRVPLKRLDLIFVTFQDS    281 - 350
RMAKRVRKDYKYVQCGVQPQQSSVTTIVKSYYWRVTMAPHPKDIIWKHLSVRRFFWWARFIAINTFLFFL    351 - 420
FFFLTTPAIIMNTIDMYNVTRPIEKLQNPIVTQFFPSVMLWGFTVILPLIVYFSAFLEAHWTRSSQNLVM    421 - 490
VHKCYIFLVFMVVILPSMGLTSLDVFLRWLFDIYYLEQASIRFQCVFLPDNGAFFVNYVITAALLGTGME    491 - 560
LLRLGSLFCYSTRLFFSRSEPERVNIRKNQAIDFQFGREYAWMMNVFSVVMAYSITCPIIVPFGLLYLCM    561 - 630
KHLTDRYNMYYSFAPTKLNEQIHMAAVSQAIFAPLLGLFWMLFFSILRLGSLHAITIFSLSTLLIAMVIA    631 - 700
FVGIFLGKLRMVADYEPEEEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMNN    701 - 770
QPEEGEEESGLRGFARELDSAQFQEGLELEGQNQYH                                      771 - 806
//

Text Mined References (9)

PMID Year Title