Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.500 6.7e-04
atypical teratoid / rhabdoid tumor 1.400 5.1e-04
glioblastoma 1.100 1.6e-02
medulloblastoma, large-cell 1.700 4.4e-05
osteosarcoma 1.584 5.1e-08
ovarian cancer 2.500 8.6e-09
pancreatic cancer -1.100 5.7e-04
posterior fossa group B ependymoma 1.200 2.2e-04
psoriasis 1.400 8.5e-39

Synonym

Accession Q9P1V8 Q2M3P3 SAM domain-containing protein 15
Symbols FAM15A
C14orf174

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEVPEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQEPQPETEEEDFKEGEPD      1 - 70
SAKNVQLKPGGTSQEGIAKESKRDVPSETEPGIHQEVKSETSREMGEFFKDLEAPMDETHKESDLEPPEE     71 - 140
AKPNVTEDVFLESAMETDPDPVPPTETMSEVSGATVRERNLELLEEETEPGVPEESLRVQHEETGLEPPE    141 - 210
QTKQDFPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFLEKEPRKSSEEAGLEP    211 - 280
PEETQPEVPEEMQRKATEEKGTELPERTKPDFPDHKPRKSTDENVPEPLEEIKLEFPEEESRKTNEETIL    281 - 350
EQSEMMKPESPEEIRKSNEKKNPQPPEETGPVLPQEINPQVEEKTQTKPTEKILELPDETKPRETHVEFS    351 - 420
KEDRPEPIKSKYSVGNDELEHREPKRGKLSLSDKFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSE    421 - 490
ECSYSDPSESQTELSEFVHEKEVVDLSQELKERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQLGFP    491 - 560
QYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLE    561 - 630
QKGHTGIKSDSLTLSEFVKAAGLQDYAPEITAPEENEELPCTEP                              631 - 674
//

Text Mined References (4)

PMID Year Title