Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.47792815102584E-39
ovarian cancer 8492 8.62363177582682E-9
osteosarcoma 7933 5.12193034060404E-8
posterior fossa group B ependymoma 1530 7.18570971672213E-7
medulloblastoma, large-cell 6234 4.37764196888452E-5
atypical teratoid / rhabdoid tumor 4369 5.09755954176992E-4
pancreatic cancer 2300 5.7143420771963E-4
adult high grade glioma 2148 6.66967538645401E-4
glioblastoma 5572 0.0157935172722489

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.584 0.000
atypical teratoid / rhabdoid tumor 1.400 0.001
glioblastoma 1.100 0.016
medulloblastoma, large-cell 1.700 0.000
pancreatic cancer -1.100 0.001
adult high grade glioma 1.500 0.001
posterior fossa group B ependymoma 2.000 0.000
ovarian cancer 2.500 0.000
psoriasis 1.400 0.000

Synonym

Accession Q9P1V8 Q2M3P3 SAM domain-containing protein 15
Symbols FAM15A
C14orf174

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid

AA Sequence

MAEVPEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAKADSKLPAEIYQEPQPETEEEDFKEGEPD      1 - 70
SAKNVQLKPGGTSQEGIAKESKRDVPSETEPGIHQEVKSETSREMGEFFKDLEAPMDETHKESDLEPPEE     71 - 140
AKPNVTEDVFLESAMETDPDPVPPTETMSEVSGATVRERNLELLEEETEPGVPEESLRVQHEETGLEPPE    141 - 210
QTKQDFPSEKLGESLEETDLQPPKMTKPETPEETQRESTEKKRTEPPEQARLEFLEKEPRKSSEEAGLEP    211 - 280
PEETQPEVPEEMQRKATEEKGTELPERTKPDFPDHKPRKSTDENVPEPLEEIKLEFPEEESRKTNEETIL    281 - 350
EQSEMMKPESPEEIRKSNEKKNPQPPEETGPVLPQEINPQVEEKTQTKPTEKILELPDETKPRETHVEFS    351 - 420
KEDRPEPIKSKYSVGNDELEHREPKRGKLSLSDKFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSE    421 - 490
ECSYSDPSESQTELSEFVHEKEVVDLSQELKERVSEDDETQPEKGTELQFEHLNWDPEEVAEWISQLGFP    491 - 560
QYKECFITNFISGRKLIHVNCSNLPQMGITNFEDMKAISRHTQELLEIEEPLFKRSISLPYRDIIGLYLE    561 - 630
QKGHTGIKSDSLTLSEFVKAAGLQDYAPEITAPEENEELPCTEP                              631 - 674
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.