Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.48
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 2.2e-02
astrocytic glioma -1.300 1.3e-02
Astrocytoma, Pilocytic -1.700 5.3e-06
atypical teratoid / rhabdoid tumor -2.200 5.4e-05
colon cancer 1.400 3.1e-05
ependymoma -1.500 3.0e-02
glioblastoma -1.200 7.7e-04
lung cancer 1.800 7.3e-04
medulloblastoma, large-cell -1.900 4.0e-04
non-inflammatory breast cancer -1.200 5.7e-03
oligodendroglioma -1.300 3.6e-02
Pick disease -1.300 3.9e-03
primitive neuroectodermal tumor -1.700 9.9e-04
psoriasis -1.200 6.8e-09

Pathway (1)

Gene RIF (2)

AA Sequence

MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP      1 - 70
TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY     71 - 140
IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE    141 - 210
REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE    211 - 280
IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS    281 - 350
EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS      351 - 418
//

Text Mined References (15)

PMID Year Title