Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.20
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 1.38895237542706E-17
psoriasis 6685 6.76317206576639E-9
pilocytic astrocytoma 3086 4.36821184993592E-7
posterior fossa group A ependymoma 1511 4.07788069552521E-6
glioblastoma 5572 2.64333931381292E-5
colon cancer 1475 3.09702288269853E-5
atypical teratoid / rhabdoid tumor 4369 5.36840788274929E-5
pediatric high grade glioma 2712 3.96930940577765E-4
medulloblastoma, large-cell 6234 4.04376917832393E-4
lung cancer 4473 7.29601899144945E-4
primitive neuroectodermal tumor 3031 9.90890196236012E-4
non-inflammatory breast cancer 208 0.00566663094367125
astrocytic glioma 2241 0.0100832066588776
Pick disease 1893 0.0275137711093871
Disease Target Count Z-score Confidence
lung adenocarcinoma 2714 3.038 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.900 0.010
posterior fossa group A ependymoma -1.600 0.000
oligodendroglioma -1.500 0.000
psoriasis -1.200 0.000
glioblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.700 0.001
colon cancer 1.400 0.000
lung cancer 1.800 0.001
pediatric high grade glioma -1.600 0.000
pilocytic astrocytoma -2.400 0.000
non-inflammatory breast cancer -1.200 0.006
Pick disease -1.400 0.028

Synonym

Accession Q9P1U1 A8MTG1 B4DFW4 Q7Z526 Q96BT2
Symbols ARP11
ARP3BETA

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
14651955 Thus, overexpression of Arp11 may suppress tumorigenicity in nude mice.

AA Sequence

MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAIDKP      1 - 70
TYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLY     71 - 140
IAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRE    141 - 210
REVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPE    211 - 280
IFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLS    281 - 350
EELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS      351 - 418
//

Text Mined References (15)

PMID Year Title
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15176487 2004 Derangement of hypothetical proteins in fetal Down's syndrome brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651955 2003 Expression of the Arp11 gene suppresses the tumorigenicity of PC-14 human lung adenocarcinoma cells.
12857853 2003 Interactions between the evolutionarily conserved, actin-related protein, Arp11, actin, and Arp1.
More...