Property Summary

NCBI Gene PubMed Count 19
PubMed Score 748.99
PubTator Score 68.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis -2.587 1.3e-02
adult high grade glioma 1.500 4.7e-03
aldosterone-producing adenoma -1.609 8.0e-03
astrocytoma 1.900 2.5e-02
Breast cancer -1.100 5.4e-04
Chronic Lymphocytic Leukemia 1.133 1.5e-02
ductal carcinoma in situ -1.700 5.1e-03
ependymoma 2.100 3.3e-10
glioblastoma 1.100 1.5e-02
group 4 medulloblastoma -1.100 3.5e-02
hereditary spastic paraplegia -1.086 1.4e-03
intraductal papillary-mucinous carcinoma... -2.500 3.9e-03
invasive ductal carcinoma -2.200 1.3e-02
lung cancer 1.200 5.6e-03
malignant mesothelioma -1.200 6.4e-06
Multiple myeloma 1.125 2.4e-02
ovarian cancer -3.700 1.0e-07
pancreatic cancer 1.100 3.8e-03
pituitary cancer -1.700 1.1e-05
primary pancreatic ductal adenocarcinoma 1.021 5.1e-03
primary Sjogren syndrome 1.200 2.4e-02
sarcoidosis 1.100 1.5e-02
spina bifida -2.681 4.9e-02

Gene RIF (13)

AA Sequence

MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGEL      1 - 70
IRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLS     71 - 140
VNSDISKKSKVNAVFSQKTGSSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGD    141 - 210
DCNCPCDMDCGIMDACCESSDCLEICMECCGICFPS                                      211 - 246
//

Text Mined References (21)

PMID Year Title