Property Summary

NCBI Gene PubMed Count 18
Grant Count 107
R01 Count 42
Funding $30,828,631.17
PubMed Score 601.89
PubTator Score 68.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P1T7 Q9P1T6
Symbols HIC

Gene

PANTHER Protein Class (1)

Gene RIF (15)

PMID Text
26469549 HIC specifically interacts with HTLV-1 Tax and negatively regulates Tax transactivational activity by altering its subcellular distribution and stability.
21401918 We demonstrate that HIC selectively interferes with Rev NLS interaction with importin beta and impedes its nuclear import and function, but does not affect Rev nuclear import mediated by transportin.
21401918 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
21401918 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
21401918 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
20417616 These data reveal for the first time that I-mfa domain proteins interact with LANA and negatively regulate LANA-mediated activation of Wnt signaling-dependent transcription by inhibiting the formation of the LANA.GSK-3beta complex.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19582149 strict regulation of HIC expression at the levels of mRNA stability, translation efficiency and protein stability suggests that expression of the HIC protein and its involvement in the various pathways is required only under specific cellular conditions
19428567 This study describes that the immune expression of HIC is cell-specific, dynamic, and identifies the HIC gene as an IL-2 responsive gene.
17289077 Downregulation of HIV-1 Rev activity by HIC is dependent on the I-mfa domain in a cell-specific manner
More...

AA Sequence

MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGEL      1 - 70
IRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLS     71 - 140
VNSDISKKSKVNAVFSQKTGSSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGD    141 - 210
DCNCPCDMDCGIMDACCESSDCLEICMECCGICFPS                                      211 - 246
//

Text Mined References (20)

PMID Year Title
26469549 2015 I-mfa domain proteins specifically interact with HTLV-1 Tax and repress its transactivating functions.
23818313 2013 Combined linkage and association analyses identify a novel locus for obesity near PROX1 in Asians.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21401918 2011 Intermolecular masking of the HIV-1 Rev NLS by the cellular protein HIC: novel insights into the regulation of Rev nuclear import.
20417616 2010 Human I-mfa domain proteins specifically interact with KSHV LANA and affect its regulation of Wnt signaling-dependent transcription.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19582149 2009 The complex regulation of HIC (Human I-mfa domain containing protein) expression.
19428567 2009 Expression profile and differential regulation of the Human I-mfa domain-Containing protein (HIC) gene in immune cells.
19041912 2009 The 3'UTR of HIC mRNA improves the production of recombinant proteins in Chinese hamster ovary cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...