Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.58
PubTator Score 19.48

Knowledge Summary

Patent (306)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.24546444933246E-12
medulloblastoma, large-cell 6234 1.98458821344209E-4
adult high grade glioma 2148 0.00418098171692517
atypical teratoid / rhabdoid tumor 4369 0.0137353855933024

Synonym

Accession Q9P1Q5 A5D914 Q6IFM1 Q6NTA9 Q96R87
Symbols OR17-7

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA Inparanoid
Horse OMA EggNOG
Cow EggNOG Inparanoid

Gene RIF (2)

PMID Text
25817041 OR1A1 activation suppresses hepatic triglyceride metabolism by modulating HES-1, PPARG, and mtGPAT expression.
17601748 Evolutionary conserved amino acid residues to be necessary for specific responsiveness of OR1A1 to odorants were identified.

AA Sequence

MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVD      1 - 70
IFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRS     71 - 140
CIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPL    141 - 210
LCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVT    211 - 280
PMLNPFIYSLRNRDMKAALRKLFNKRISS                                             281 - 309
//

Text Mined References (7)

PMID Year Title
25817041 2015 Activation of OR1A1 suppresses PPAR-? expression by inducing HES-1 in cultured hepatocytes.
17601748 2007 Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.