Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.58
PubTator Score 19.48

Knowledge Summary

Patent (306)

Gene RIF (2)

PMID Text
25817041 OR1A1 activation suppresses hepatic triglyceride metabolism by modulating HES-1, PPARG, and mtGPAT expression.
17601748 Evolutionary conserved amino acid residues to be necessary for specific responsiveness of OR1A1 to odorants were identified.

AA Sequence

MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVD      1 - 70
IFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRS     71 - 140
CIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPL    141 - 210
LCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVT    211 - 280
PMLNPFIYSLRNRDMKAALRKLFNKRISS                                             281 - 309
//

Text Mined References (7)

PMID Year Title
25817041 2015 Activation of OR1A1 suppresses PPAR-? expression by inducing HES-1 in cultured hepatocytes.
17601748 2007 Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
10673334 2000 Sequence, structure, and evolution of a complete human olfactory receptor gene cluster.