Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.33
PubTator Score 19.48

Knowledge Summary

Patent (306)

TINX Plot

  Disease (2)

Gene RIF (2)

AA Sequence

MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVD      1 - 70
IFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRS     71 - 140
CIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPL    141 - 210
LCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVT    211 - 280
PMLNPFIYSLRNRDMKAALRKLFNKRISS                                             281 - 309
//

Text Mined References (7)

PMID Year Title