Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.69
PubTator Score 12.29

Knowledge Summary

Patent (1,721)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Idiopathic generalized epilepsy 14 3.156 1.6

Gene RIF (2)

AA Sequence

MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFGNLAMIISISY      1 - 70
FKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYYSFDLMLSITSIFHLCSVAID     71 - 140
RFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWG    141 - 210
TTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFF    211 - 280
TILLDPFLNFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKES    281 - 350
E//

Text Mined References (8)

PMID Year Title