Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.82
PubTator Score 12.29

Knowledge Summary

Patent (1,721)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Idiopathic generalized epilepsy 15 3.142 1.6

Synonym

Accession Q9P1P5 Q5QD02 Q6NWS1 Q6NWS2 Q6NWS3 TaR-2
Symbols GPR58
taR-2

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Gene RIF (2)

PMID Text
23315425 biogenic amines potently regulate blood cell functions via TAAR1 and TAAR2 and open the perspective of their specific pharmacological modulation.
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFGNLAMIISISY      1 - 70
FKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYYSFDLMLSITSIFHLCSVAID     71 - 140
RFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWG    141 - 210
TTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFF    211 - 280
TILLDPFLNFSTPVVLFDALTWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKES    281 - 350
E//

Text Mined References (8)

PMID Year Title
23315425 2013 Biogenic amines activate blood leukocytes via trace amine-associated receptors TAAR1 and TAAR2.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10684976 2000 Cloning and characterization of additional members of the G protein-coupled receptor family.