Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFKQLHSPTNFLI      1 - 70
LSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIFHLCSIAIDRFYAVCYPLHYT     71 - 140
TKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYKILVACFNFCALTFNKFWGTILFTTCFFTPG    141 - 210
SIMVGIYGKIFIVSKQHARVISHVPENTKGAVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDP    211 - 280
YLDYSTPILILDLLVWLRYFNSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH           281 - 343
//

Text Mined References (9)

PMID Year Title
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
19325074 2009 International Union of Pharmacology. LXXII. Recommendations for trace amine receptor nomenclature.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
15891052 2005 High species variation within the repertoire of trace amine receptors.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
14559210 2003 Discovery of a null mutation in a human trace amine receptor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10684976 2000 Cloning and characterization of additional members of the G protein-coupled receptor family.