Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MDLTYIPEDLSSCPKFVNKILSSHQPLFSCPGDNVFGYDWSHDYPLFGNLVIMVSISHFKQLHSPTNFLI      1 - 70
LSMATTDFLLGFVIMPYSIMRSVESCWYFGDGFCKFHTSFDMMLRLTSIFHLCSIAIDRFYAVCYPLHYT     71 - 140
TKMTNSTIKQLLAFCWSVPALFSFGLVLSEADVSGMQSYKILVACFNFCALTFNKFWGTILFTTCFFTPG    141 - 210
SIMVGIYGKIFIVSKQHARVISHVPENTKGAVKKHLSKKKDRKAAKTLGIVMGVFLACWLPCFLAVLIDP    211 - 280
YLDYSTPILILDLLVWLRYFNSTCNPLIHGFFNPWFQKAFKYIVSGKIFSSHSETANLFPEAH           281 - 343
//

Text Mined References (9)

PMID Year Title