Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.32
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.754 2.7e-03
astrocytic glioma -2.700 2.8e-03
Breast cancer 3.200 2.6e-02
breast carcinoma 1.200 4.4e-16
cystic fibrosis 1.037 5.2e-04
ductal carcinoma in situ 2.000 4.5e-04
ependymoma -2.500 1.1e-02
gastric carcinoma 1.100 3.0e-02
intraductal papillary-mucinous adenoma (... 1.500 3.6e-02
intraductal papillary-mucinous carcinoma... 1.600 3.6e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.0e-02
invasive ductal carcinoma 1.700 1.3e-02
juvenile dermatomyositis 1.437 1.3e-08
lung carcinoma -2.000 3.6e-22
medulloblastoma, large-cell -1.200 4.3e-02
oligodendroglioma -2.700 4.3e-03
osteosarcoma -1.674 4.1e-03
ovarian cancer -1.900 7.5e-05
pancreatic cancer 1.100 5.2e-04
pancreatic ductal adenocarcinoma liver m... -1.886 9.1e-03
pituitary cancer -1.200 3.7e-02
Pneumonia -1.100 1.2e-02

Gene RIF (1)

AA Sequence

MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGV      1 - 70
HDDVDIILLQD                                                                71 - 81
//

Text Mined References (10)

PMID Year Title