Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.98
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 3.62679999501614E-22
breast carcinoma 1614 4.35013149960341E-16
juvenile dermatomyositis 1189 1.31203926606817E-8
ovarian cancer 8492 5.60591547754056E-5
ductal carcinoma in situ 1745 4.48156679784191E-4
cystic fibrosis 1670 5.19448114719639E-4
adrenocortical carcinoma 1427 0.00273331470808282
astrocytic glioma 2241 0.0028227446388092
osteosarcoma 7933 0.00407228089301439
oligodendroglioma 2849 0.00432052154361775
pancreatic cancer 2300 0.00780668414818857
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00911561163657531
ependymoma 2514 0.0112426142976773
Pneumonia 133 0.0117971885604816
invasive ductal carcinoma 2950 0.0125376777594686
Breast cancer 3099 0.0259889637897627
gastric carcinoma 832 0.0301639742454173
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.036004093812153
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0360797525656597
pituitary cancer 1972 0.0372095795268252
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.040406389448318
medulloblastoma, large-cell 6234 0.0430757745075001

Expression

Synonym

Accession Q9P1F3 Q5SZC8 Q9P0A1
Symbols Costars
HSPC280
PRO2013
C6orf115

Gene

PDB

2L2O  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
21082705 Solution structure of the human HSPC280 protein

AA Sequence

MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGV      1 - 70
HDDVDIILLQD                                                                71 - 81
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21082705 2011 Solution structure of the human HSPC280 protein.
20940261 2010 Costars, a Dictyostelium protein similar to the C-terminal domain of STARS, regulates the actin cytoskeleton and motility.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15723814 2005 A proteomic analysis of human hemodialysis fluid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.