Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.98
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9P1F3 Q5SZC8 Q9P0A1
Symbols Costars
HSPC280
PRO2013
C6orf115

Gene

PDB

2L2O  

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
21082705 Solution structure of the human HSPC280 protein

AA Sequence

MNVDHEVNLLVEEIHRLGSKNADGKLSVKFGVLFRDDKCANLFEALVGTLKAAKRRKIVTYPGELLLQGV      1 - 70
HDDVDIILLQD                                                                71 - 81
//

Text Mined References (10)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21082705 2011 Solution structure of the human HSPC280 protein.
20940261 2010 Costars, a Dictyostelium protein similar to the C-terminal domain of STARS, regulates the actin cytoskeleton and motility.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15723814 2005 A proteomic analysis of human hemodialysis fluid.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.