Knowledge Summary

Patent

No data available

Synonym

Accession Q9P1D8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MMITRGWEGWGRRGARGAGTGTGLGGPGTPESSVTPPEFPLPPATRITPNFPNTLDPAISRSSS            1 - 64
//