Knowledge Summary

Patent

No data available

Synonym

Accession Q9P1C3
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MVRPHLLKKKILGRVWWLMPVVLALWEAEVGGSLEVRSLRPAWPTW                              1 - 46
//