Knowledge Summary

Patent

No data available

AA Sequence

MVRPHLLKKKILGRVWWLMPVVLALWEAEVGGSLEVRSLRPAWPTW                              1 - 46
//