Property Summary

NCBI Gene PubMed Count 25
PubMed Score 22.60
PubTator Score 23.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.700 9.9e-03
astrocytic glioma -2.900 5.7e-04
Astrocytoma, Pilocytic -3.700 6.7e-06
atypical teratoid / rhabdoid tumor -4.400 4.6e-08
ependymoma -3.600 4.9e-04
glioblastoma -3.200 5.6e-07
group 3 medulloblastoma -2.800 4.6e-02
medulloblastoma, large-cell -4.100 1.4e-03
oligodendroglioma -2.800 1.7e-03
Pick disease -1.400 3.9e-02
pituitary cancer -1.800 4.1e-03
primitive neuroectodermal tumor -3.800 1.2e-03

Gene RIF (11)

AA Sequence

MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEAGDLVQPGISFPGPAEEDLDPQYSWSPTQHFNE      1 - 70
ERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYLLSPADSCPGGRHRCSPRSSV     71 - 140
HSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHAGAKINRIPANLLDQFEKQLPLHRDGFHTLQ    141 - 210
YQRTSAAAEQRSESPGRIRHLVHSVQKLFTKSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSK    211 - 280
ERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKC    281 - 350
SACEGLALTPDAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPT    351 - 420
GGKDEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPKSAILPEPLLKSIGQRPLGEHQTQTYLQAASDV    421 - 490
PVGHSLDPAANYNSPKFRSRNQSYMRAVSTLSQASCVSQVSEAEINGQFESVCESVFSEVESQAMDALDL    491 - 560
PGCFRTRSHSYLRAIQAGYSQDDECIPMMTPSDITSTIRSTAAVSYTNYKKTPPPVPPRTTSKPLISVTA    561 - 630
QSSTESTQDAYQDSRAQRMSPWPQDSRGLYNSTDSLDSNKAMNLALETAAAQRHLPESQSSSVRTSDKAI    631 - 700
LVSKAEELLKSRCSSIGIQDSEFPEHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSN    701 - 770
SVTAAVQADLELEGFPGHITTEDKGLQFGSSFQRHSEPSTPTQYSAVRTVRTQGLFSYREDYRTQVDTST    771 - 840
LPPPDPWLEPAIDTVETGRMSPCRRDGSWFLKLLHAETKRMEGWCKEMEREAEENDLSEEILGKIRSAVG    841 - 910
SAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSIEDVSMKFDELQRLRLNDWKMMESPE    911 - 980
RKEERKVPPPIPKKPPKGKFPITREKSLDLPDRQRQEARRRLMAAKRAASFRQNSASERADSIEIYIPEA    981 - 1050
QTRL                                                                     1051 - 1054
//

Text Mined References (25)

PMID Year Title