Property Summary

NCBI Gene PubMed Count 22
Grant Count 5
R01 Count 4
Funding $324,095.21
PubMed Score 19.77
PubTator Score 23.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.900 0.001
posterior fossa group A ependymoma -3.900 0.000
oligodendroglioma -2.800 0.002
glioblastoma -4.500 0.000
medulloblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -4.100 0.001
primitive neuroectodermal tumor -3.800 0.001
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -3.600 0.000
Pick disease -1.400 0.039
pituitary cancer -1.800 0.004

Gene RIF (10)

PMID Text
25391383 The Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study.
24416398 DLGAP2 is a susceptible gene of schizophrenia.
23154099 this study demonistrated that two SNPs in DLGAP2 (rs6558484 and rs7014992) and prefrontal cortex white matter volume.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20531469 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
18055845 DLGAP2 gene is imprinted, with preferential expression from the paternal allele in testis.
15030493 Increased expression of PSD-25 and its coassembly with NMDA-receptor subunits NR1 and MR2B in resected epileptic cortical tissue suggest a possible functional role of the complex in in situ epileptogenicity of focal cortical dysplasia.

AA Sequence

MGTAQVLPGILQKHCCILPDRNTESQCTLCGEPEEEEAGDLVQPGISFPGPAEEDLDPQYSWSPTQHFNE      1 - 70
ERYSPAPRSMKGLSGSRTQPPLCSGHTCGLAPPEDCEHLHHGPDARPPYLLSPADSCPGGRHRCSPRSSV     71 - 140
HSECVMMPVVLGDHVSSSTFPRMHYSSHYDTRDDCAVAHAGAKINRIPANLLDQFEKQLPLHRDGFHTLQ    141 - 210
YQRTSAAAEQRSESPGRIRHLVHSVQKLFTKSHSLEGSSKSNANGTKADGRADDHHHAHHAKHSKRSKSK    211 - 280
ERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKC    281 - 350
SACEGLALTPDAKYLKRSSWSTLTVSQAKEAYRKSSLNLDKPLLHQDAKPALRPCHYLQVPQDEWGGYPT    351 - 420
GGKDEEIPCRRMRSGSYIKAMGDEESGESDSSPKTSPKSAILPEPLLKSIGQRPLGEHQTQTYLQAASDV    421 - 490
PVGHSLDPAANYNSPKFRSRNQSYMRAVSTLSQASCVSQVSEAEINGQFESVCESVFSEVESQAMDALDL    491 - 560
PGCFRTRSHSYLRAIQAGYSQDDECIPMMTPSDITSTIRSTAAVSYTNYKKTPPPVPPRTTSKPLISVTA    561 - 630
QSSTESTQDAYQDSRAQRMSPWPQDSRGLYNSTDSLDSNKAMNLALETAAAQRHLPESQSSSVRTSDKAI    631 - 700
LVSKAEELLKSRCSSIGIQDSEFPEHQPYPRSDVETATDSDTESRGLREYHSVGVQVEDEKRHGRFKRSN    701 - 770
SVTAAVQADLELEGFPGHITTEDKGLQFGSSFQRHSEPSTPTQYSAVRTVRTQGLFSYREDYRTQVDTST    771 - 840
LPPPDPWLEPAIDTVETGRMSPCRRDGSWFLKLLHAETKRMEGWCKEMEREAEENDLSEEILGKIRSAVG    841 - 910
SAQLLMSQKFQQFYWLCQQNMDPSAMPRPTSQDLAGYWDMLQLSIEDVSMKFDELQRLRLNDWKMMESPE    911 - 980
RKEERKVPPPIPKKPPKGKFPITREKSLDLPDRQRQEARRRLMAAKRAASFRQNSASERADSIEIYIPEA    981 - 1050
QTRL                                                                     1051 - 1054
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24416398 2014 Role of the DLGAP2 gene encoding the SAP90/PSD-95-associated protein 2 in schizophrenia.
23599027 2013 Genome-wide association study of age at menarche in African-American women.
23154099 2013 Glutamate system genes and brain volume alterations in pediatric obsessive-compulsive disorder: a preliminary study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20531469 2010 Functional impact of global rare copy number variation in autism spectrum disorders.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...