Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9P1A2 B4DRM4 Q96LY6 Q9BZ17 Q9BZ18
Symbols PRO1085
PPP4R1P1
C20orf192

Gene

 Compartment GO Term (1)

AA Sequence

MAEIPLYFVDLQDDLDDYGFEDYGTDCDNMRVTAFLDIPGQDNLPPLTRLEKYAFSENTFNRQIIARGLL      1 - 70
DIFRDFGNNEEDFLTVMEIVVRLSEDAEPTVRTELMEQIPPIAIFLQENRSNFPVVLSEYLIPIVVRYLT     71 - 140
DPNNQIICKMASMLSKSTVERLLLPRFCELCGDRKLFQVRKVCAANFGDICHAVGQEATEKFLIPKFFEL    141 - 210
CSDAVWGMRKACAECFTAVSHSSSPGVRRTQLFPLFIRLVSDPCRWVHQAAFQSLGPFTSTFANPSRAGL    211 - 280
YLREDGALSIWPLTQDLDSGFASGSPAPSSGGNTSPASLTRSAKPVRSEPELPVEGTSAKTSDCPHSSSS    281 - 350
SDGPAESPVESCVSAGAEWTRVSPETSACSKLSDMNDLPISSYPGSDSWACPGNTEDVFSHFLYW         351 - 415
//

Text Mined References (4)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.