Property Summary

NCBI Gene PubMed Count 6
PubMed Score 15.07
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

PMID Text
25662211 Luzp4 is an RNA-binding protein which associates with the TREX mRNA export complex subunit Uap56. Luzp4 also binds the principal mRNA export receptor Nxf1, enhances its RNA binding activity and complements Alyref knockdown in vivo. Luzp4 displays all features of an mRNA export adaptor. Whilst Luzp4 is up-regulated in a range of tumours, it appears preferentially expressed in melanoma cells where it is required for growth.
12032826 A novel tumour associated leucine zipper protein targeting to sites of gene transcription and splicing.

AA Sequence

MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDDIIIYKELEGTNAEEEKNKRQNHSKKESPSRQQSKAHRH      1 - 70
RHRRGYSRCRSNSEEGNHDKKPSQKPSGFKSGQHPLNGQPLIEQEKCSDNYEAQAEKNQGQSEGNQHQSE     71 - 140
GNPDKSEESQGQPEENHHSERSRNHLERSLSQSDRSQGQLKRHHPQYERSHGQYKRSHGQSERSHGHSER    141 - 210
SHGHSERSHGHSERSHGHSKRSRSQGDLVDTQSDLIATQRDLIATQKDLIATQRDLIATQRDLIVTQRDL    211 - 280
VATERDLINQSGRSHGQSERHQRYSTGKNTITT                                         281 - 313
//

Text Mined References (10)

PMID Year Title
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032826 2002 A novel tumour associated leucine zipper protein targeting to sites of gene transcription and splicing.
11051238 2000 Expression of cancer testis genes in human brain tumors.