Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.00
PubTator Score 28.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.1e-11
osteosarcoma 7950 4.0e-08
medulloblastoma, large-cell 6241 4.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Parapsoriasis 6 3.596 1.8

Gene RIF (2)

AA Sequence

MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDDIIIYKELEGTNAEEEKNKRQNHSKKESPSRQQSKAHRH      1 - 70
RHRRGYSRCRSNSEEGNHDKKPSQKPSGFKSGQHPLNGQPLIEQEKCSDNYEAQAEKNQGQSEGNQHQSE     71 - 140
GNPDKSEESQGQPEENHHSERSRNHLERSLSQSDRSQGQLKRHHPQYERSHGQYKRSHGQSERSHGHSER    141 - 210
SHGHSERSHGHSERSHGHSKRSRSQGDLVDTQSDLIATQRDLIATQKDLIATQRDLIATQRDLIVTQRDL    211 - 280
VATERDLINQSGRSHGQSERHQRYSTGKNTITT                                         281 - 313
//

Text Mined References (11)

PMID Year Title