Property Summary

NCBI Gene PubMed Count 34
PubMed Score 79.15
PubTator Score 59.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.58037629729624E-6
pancreatic cancer 2300 2.27914926320098E-4
pancreatic carcinoma 567 2.27914926320103E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.61737817538377E-4
gastric cancer 436 6.74715535501758E-4
hepatocellular carcinoma 550 0.00620377907273964
axial spondyloarthropathy 28 0.0435238419747192

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.500 0.001
hepatocellular carcinoma 1.400 0.006
pancreatic cancer 1.700 0.000
osteosarcoma -3.841 0.000
pancreatic ductal adenocarcinoma liver m... -2.952 0.001
pancreatic carcinoma 1.700 0.000
axial spondyloarthropathy 1.100 0.044

Synonym

Accession Q9P126 Q6UWX7 Q8NHR6
Symbols CLEC2
CLEC2B
PRO1384
QDED721
1810061I13Rik

Gene

PDB

3WSR   2C6U   3WWK  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG

Gene RIF (27)

PMID Text
25858425 CLEC-2 regulates Akt and MAPK downstream of PI3K and PKC, leading to phosphorylation and inhibition of GSK3alpha/beta, and enhanced platelet aggregation and secretion.
25849538 Data (including data from studies using recombinant proteins) suggest that a diverse range of ligands activate platelets through activation/phosphorylation of CD36/GPVI (glycoprotein VI) and/or CLEC-2 (C-type lectin-like receptor-2).
25767114 PI3K and Tec family kinases play a crucial role in the regulation of platelet activation and Syk phosphorylation downstream of the CLEC-2 receptor
23341451 fucoidan is a novel CLEC-2 receptor agonist that activates platelets through a SFK-dependent signaling pathway
23264619 Dimerization of two phosphorylated CLEC-2 molecules leads to recruitment of the tyrosine kinase Syk via its tandem SH2 domains and initiation of a downstream signaling cascade
23053573 A differential proteomic analysis of basal and rhodocytin-activated platelets with the aim of providing novel clues on CLEC-2 signaling regulation.
22740230 The glycosylation sites (N120 and N134) are necessary for the surface expression of CLEC-2.
22736279 Shedding of CLEC-2 from the cell surface may reflect increased expression of this membrane protein and serve as a marker of disease activity.
22682130 Here, the bidirectional relationship between CLEC-2 and podoplanin is described and considered in the context of tumour growth and metastasis.
22556408 platelets regulate blood/lymphatic vessel separation by inhibiting the proliferation, migration, and tube formation of LECs, mainly because of the release of BMP-9 upon activation by CLEC-2/podoplanin in
More...

AA Sequence

MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRT      1 - 70
GTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKI     71 - 140
DNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCEN    141 - 210
KHYLMCERKAGMTKVDQLP                                                       211 - 229
//

Text Mined References (34)

PMID Year Title
25858425 2015 Akt and mitogen-activated protein kinase enhance C-type lectin-like receptor 2-mediated platelet activation by inhibition of glycogen synthase kinase 3?/?.
25849538 2015 Activation of glycoprotein VI (GPVI) and C-type lectin-like receptor-2 (CLEC-2) underlies platelet activation by diesel exhaust particles and other charged/hydrophobic ligands.
25767114 2015 Distinct pathways regulate Syk protein activation downstream of immune tyrosine activation motif (ITAM) and hemITAM receptors in platelets.
23341451 2013 Fucoidan is a novel platelet agonist for the C-type lectin-like receptor 2 (CLEC-2).
23264619 2013 Critical Role for an acidic amino acid region in platelet signaling by the HemITAM (hemi-immunoreceptor tyrosine-based activation motif) containing receptor CLEC-2 (C-type lectin receptor-2).
23053573 2012 A detailed proteomic analysis of rhodocytin-activated platelets reveals novel clues on the CLEC-2 signalosome: implications for CLEC-2 signaling regulation.
22740230 2012 Structural and functional conservation of CLEC-2 with the species-specific regulation of transcript expression in evolution.
22736279 2012 The production of soluble C-type lectin-like receptor 2 is a regulated process.
22682130 2012 Platelet CLEC-2 and podoplanin in cancer metastasis.
22556408 2012 Platelet activation receptor CLEC-2 regulates blood/lymphatic vessel separation by inhibiting proliferation, migration, and tube formation of lymphatic endothelial cells.
More...