Property Summary

NCBI Gene PubMed Count 38
PubMed Score 93.64
PubTator Score 59.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
axial spondyloarthropathy 1.100 4.4e-02
gastric cancer 1.500 6.7e-04
hepatocellular carcinoma 1.400 6.2e-03
osteosarcoma -3.841 3.6e-06
pancreatic cancer 1.700 2.3e-04
pancreatic carcinoma 1.700 2.3e-04
pancreatic ductal adenocarcinoma liver m... -2.952 6.6e-04

Gene RIF (31)

AA Sequence

MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRT      1 - 70
GTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKI     71 - 140
DNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCEN    141 - 210
KHYLMCERKAGMTKVDQLP                                                       211 - 229
//

Text Mined References (38)

PMID Year Title