Property Summary

NCBI Gene PubMed Count 34
Grant Count 26
R01 Count 7
Funding $9,862,833.98
PubMed Score 79.15
PubTator Score 59.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.500 0.001
hepatocellular carcinoma 1.400 0.006
pancreatic cancer 1.700 0.000
osteosarcoma -3.841 0.000
pancreatic ductal adenocarcinoma liver m... -2.952 0.001
pancreatic carcinoma 1.700 0.000
axial spondyloarthropathy 1.100 0.044

Gene RIF (27)

PMID Text
25858425 CLEC-2 regulates Akt and MAPK downstream of PI3K and PKC, leading to phosphorylation and inhibition of GSK3alpha/beta, and enhanced platelet aggregation and secretion.
25849538 Data (including data from studies using recombinant proteins) suggest that a diverse range of ligands activate platelets through activation/phosphorylation of CD36/GPVI (glycoprotein VI) and/or CLEC-2 (C-type lectin-like receptor-2).
25767114 PI3K and Tec family kinases play a crucial role in the regulation of platelet activation and Syk phosphorylation downstream of the CLEC-2 receptor
23341451 fucoidan is a novel CLEC-2 receptor agonist that activates platelets through a SFK-dependent signaling pathway
23264619 Dimerization of two phosphorylated CLEC-2 molecules leads to recruitment of the tyrosine kinase Syk via its tandem SH2 domains and initiation of a downstream signaling cascade
23053573 A differential proteomic analysis of basal and rhodocytin-activated platelets with the aim of providing novel clues on CLEC-2 signaling regulation.
22740230 The glycosylation sites (N120 and N134) are necessary for the surface expression of CLEC-2.
22736279 Shedding of CLEC-2 from the cell surface may reflect increased expression of this membrane protein and serve as a marker of disease activity.
22682130 Here, the bidirectional relationship between CLEC-2 and podoplanin is described and considered in the context of tumour growth and metastasis.
22556408 platelets regulate blood/lymphatic vessel separation by inhibiting the proliferation, migration, and tube formation of LECs, mainly because of the release of BMP-9 upon activation by CLEC-2/podoplanin in
More...

AA Sequence

MQDEDGYITLNIKTRKPALISVGSASSSWWRVMALILLILCVGMVVGLVALGIWSVMQRNYLQGENENRT      1 - 70
GTLQQLAKRFCQYVVKQSELKGTFKGHKCSPCDTNWRYYGDSCYGFFRHNLTWEESKQYCTDMNATLLKI     71 - 140
DNRNIVEYIKARTHLIRWVGLSRQKSNEVWKWEDGSVISENMFEFLEDGKGNMNCAYFHNGKMHPTFCEN    141 - 210
KHYLMCERKAGMTKVDQLP                                                       211 - 229
//

Text Mined References (34)

PMID Year Title
25858425 2015 Akt and mitogen-activated protein kinase enhance C-type lectin-like receptor 2-mediated platelet activation by inhibition of glycogen synthase kinase 3?/?.
25849538 2015 Activation of glycoprotein VI (GPVI) and C-type lectin-like receptor-2 (CLEC-2) underlies platelet activation by diesel exhaust particles and other charged/hydrophobic ligands.
25767114 2015 Distinct pathways regulate Syk protein activation downstream of immune tyrosine activation motif (ITAM) and hemITAM receptors in platelets.
23341451 2013 Fucoidan is a novel platelet agonist for the C-type lectin-like receptor 2 (CLEC-2).
23264619 2013 Critical Role for an acidic amino acid region in platelet signaling by the HemITAM (hemi-immunoreceptor tyrosine-based activation motif) containing receptor CLEC-2 (C-type lectin receptor-2).
23053573 2012 A detailed proteomic analysis of rhodocytin-activated platelets reveals novel clues on the CLEC-2 signalosome: implications for CLEC-2 signaling regulation.
22740230 2012 Structural and functional conservation of CLEC-2 with the species-specific regulation of transcript expression in evolution.
22736279 2012 The production of soluble C-type lectin-like receptor 2 is a regulated process.
22682130 2012 Platelet CLEC-2 and podoplanin in cancer metastasis.
22556408 2012 Platelet activation receptor CLEC-2 regulates blood/lymphatic vessel separation by inhibiting proliferation, migration, and tube formation of lymphatic endothelial cells.
More...