Property Summary

NCBI Gene PubMed Count 28
PubMed Score 47.10
PubTator Score 73.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.600 9.4e-06
atypical teratoid / rhabdoid tumor -3.200 6.5e-10
Breast cancer 1.800 1.0e-02
cystic fibrosis 2.747 4.9e-07
Gaucher disease type 3 1.100 4.7e-02
glioblastoma -1.900 1.5e-07
group 3 medulloblastoma -2.600 1.1e-07
intraductal papillary-mucinous adenoma (... -1.700 2.9e-02
invasive ductal carcinoma 1.391 1.5e-03
lung adenocarcinoma -1.100 1.4e-03
lung cancer -2.100 2.0e-03
lung carcinoma -1.600 1.6e-03
malignant mesothelioma 5.200 3.9e-09
medulloblastoma, large-cell -2.900 8.1e-06
ovarian cancer 1.700 3.3e-02
pancreatic cancer 1.200 8.8e-04
permanent atrial fibrillation -1.300 3.7e-04
primary pancreatic ductal adenocarcinoma 2.811 4.7e-04
psoriasis -1.100 2.4e-03
subependymal giant cell astrocytoma -2.457 4.8e-02
urothelial carcinoma 1.400 5.0e-02

 CSPA Cell Line (1)

Protein-protein Interaction (3)

Gene RIF (12)

AA Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLN      1 - 70
RSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE     71 - 140
ISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAP    141 - 210
VVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKL    211 - 280
IFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF          281 - 344
//

Text Mined References (28)

PMID Year Title