Property Summary

NCBI Gene PubMed Count 28
PubMed Score 43.37
PubTator Score 73.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 9.9830831113443E-28
sonic hedgehog group medulloblastoma 1482 1.4962198035324E-10
atypical teratoid / rhabdoid tumor 4369 2.59821108326962E-9
malignant mesothelioma 3163 3.94104482493813E-9
cystic fibrosis 1670 6.26788174262837E-8
lung cancer 4473 5.75311769700333E-7
medulloblastoma, large-cell 6234 2.36968726009164E-5
pediatric high grade glioma 2712 1.13582676255395E-4
glioblastoma 5572 3.02983307097259E-4
permanent atrial fibrillation 44 3.73091906930745E-4
primary pancreatic ductal adenocarcinoma 1271 4.74647129886161E-4
pancreatic cancer 2300 5.97910128957547E-4
lung adenocarcinoma 2714 0.00137049083891949
lung carcinoma 2844 0.00157183248682444
invasive ductal carcinoma 2950 0.00207601132576977
Breast cancer 3099 0.0102706267933697
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0290896820776628
ovarian cancer 8492 0.0304278159583903
Gaucher disease type 3 76 0.0470093167448155
subependymal giant cell astrocytoma 2287 0.0481190051992258
urothelial carcinoma 318 0.0498516956578292
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 1.0
Cognitive disorder 44 0.0 1.0
Disease Target Count Z-score Confidence
Juvenile pilocytic astrocytoma 2 4.057 2.0
Chagas disease 34 3.114 1.6

Expression

Synonym

Accession Q9P121 A0MTT2 Q6UXJ3 Q86VJ9 hNT
Symbols HNT
NTRI
IGLON2

Gene

NTM

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

 CSPA Cell Line (1)

Gene RIF (12)

PMID Text
26334118 NTM is not a susceptibility gene for autism spectrum disorders.
25819087 Both the AFF3 and NTM triglyceride associations were replicated among Multi-ethnic Study of Atherosclerosis study participants (P = 1.00 x 10(-7) and 8.00 x 10(-5), respectively).
24616287 The generation and cardiac phenotype of single and double heterozygous gene-targeted OPCML and Neurotrimin knockout mice.
23054244 A translocation breaks intron 1 of a splicing isoform of Neurotrimin at 11q25 in a family with intracranial and thoracic aortic aneurysm.
22661486 A quantitative analysis of central corneal thickness and a subsequent analysis of primary open-angle glaucoma (POAG), SNPs in two cell adhesion molecules, NTM and CNTNAP4, were identified and may increase POAG susceptibility in a subset of cases.
21036197 The finding of this study provided evidence that NTM at 11q25 chromosome regions affecting IQ.
21036197 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLN      1 - 70
RSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE     71 - 140
ISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAP    141 - 210
VVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKL    211 - 280
IFFNVSEHDYGNYTCVASNKLGHTNASIMLFGPGAVSEVSNGTSRRAGCVWLLPLLVLHLLLKF          281 - 344
//

Text Mined References (28)

PMID Year Title
26334118 2015 11q24.2-25 micro-rearrangements in autism spectrum disorders: Relation to brain structures.
25819087 2015 Genome-wide linkage and positional association analyses identify associations of novel AFF3 and NTM genes with triglycerides: the GenSalt study.
25416956 2014 A proteome-scale map of the human interactome network.
24616287 2014 Gene-targeted deletion of OPCML and Neurotrimin in mice does not yield congenital heart defects.
23548203 2013 Genome-wide association studies identify several new loci associated with pigmentation traits and skin cancer risk in European Americans.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23054244 2012 A balanced translocation truncates Neurotrimin in a family with intracranial and thoracic aortic aneurysm.
22661486 2012 Genome-wide analysis of central corneal thickness in primary open-angle glaucoma cases in the NEIGHBOR and GLAUGEN consortia.
More...