Property Summary

NCBI Gene PubMed Count 2
PubMed Score 33.66
PubTator Score 1.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.1e-115
lung adenocarcinoma 2716 1.0e-12
lung cancer 4740 3.3e-04
uncontrolled asthma 56 2.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mast cell neoplasm 8 4.841 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.300 1.0e-12
lung cancer -1.700 3.3e-04
psoriasis 2.100 3.1e-115
uncontrolled asthma 1.800 2.7e-03

AA Sequence

MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRYTHVKDEVRYE      1 - 70
VNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYAQKLVSKEEKSFPIAYSLVVH     71 - 140
KDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCL    141 - 210
SDLLKSSIQWKYVINLCGQDFPLKSNFELVSELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVK    211 - 280
LPIRTNISKEAPPHNIQIFVGSAYFVLSQAFVKYIFNNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPG    281 - 350
EISRSAQDVSDLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPIL    351 - 420
IKCLAEKLEEQQRDWITLPSEKLFMDRNLTTTS                                         421 - 453
//

Text Mined References (2)

PMID Year Title