Property Summary

NCBI Gene PubMed Count 2
PubMed Score 33.08
PubTator Score 1.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
uncontrolled asthma 1.800 0.003
lung cancer -1.700 0.000
lung adenocarcinoma -1.300 0.000
psoriasis 2.100 0.000

Synonym

Accession Q9P109
Symbols C2GNT3

Gene

PANTHER Protein Class (2)

AA Sequence

MKIFKCYFKHTLQQKVFILFLTLWLLSLLKLLNVRRLFPQKDIYLVEYSLSTSPFVRNRYTHVKDEVRYE      1 - 70
VNCSGIYEQEPLEIGKSLEIRRRDIIDLEDDDVVAMTSDCDIYQTLRGYAQKLVSKEEKSFPIAYSLVVH     71 - 140
KDAIMVERLIHAIYNQHNIYCIHYDRKAPDTFKVAMNNLAKCFSNIFIASKLEAVEYAHISRLQADLNCL    141 - 210
SDLLKSSIQWKYVINLCGQDFPLKSNFELVSELKKLNGANMLETVKPPNSKLERFTYHHELRRVPYEYVK    211 - 280
LPIRTNISKEAPPHNIQIFVGSAYFVLSQAFVKYIFNNSIVQDFFAWSKDTYSPDEHFWATLIRVPGIPG    281 - 350
EISRSAQDVSDLQSKTRLVKWNYYEGFFYPSCTGSHLRSVCIYGAAELRWLIKDGHWFANKFDSKVDPIL    351 - 420
IKCLAEKLEEQQRDWITLPSEKLFMDRNLTTTS                                         421 - 453
//

Text Mined References (2)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
10753916 2000 Control of O-glycan branch formation. Molecular cloning and characterization of a novel thymus-associated core 2 beta1, 6-n-acetylglucosaminyltransferase.