Property Summary

NCBI Gene PubMed Count 22
Grant Count 6
R01 Count 5
Funding $1,086,336.33
PubMed Score 10.53
PubTator Score 16.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
24551065 IGFBP-5 induces its pro-fibrotic effects, at least in part, via DOK5. IGFBP-5 and DOK5 are both increased in systemic sclerosis fibroblasts and tissues and may thus be acting in concert to promote fibrosis.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20215924 Although preliminary, these data suggest that DOK5 and perhaps several other genes influence the magnitude of amygdala activation during face processing, particularly in those with BD.
20215924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20187968 identified DOK5 as a novel susceptibility gene for obesity and type 2 diabetes in North Indian subjects
20187968 Observational study of gene-disease association. (HuGE Navigator)
12730241 IRS5/DOK4 and IRS6/DOK5 represent two new signaling proteins with potential roles in insulin and IGF-1 action
12595900 DOK5 expression in human T cells, its genomic structure characterized, and its regulation upon T cell activation has been demonstrated.

AA Sequence

MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVTELNNVKNVAR      1 - 70
LPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDISLGEPDLLATGVEREQSERFN     71 - 140
VYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFI    141 - 210
FQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQ    211 - 280
LYRLQDVSSPLKLHRTETFPAYRSEH                                                281 - 306
//

Text Mined References (23)

PMID Year Title
24551065 2014 The membrane-associated adaptor protein DOK5 is upregulated in systemic sclerosis and associated with IGFBP-5-induced fibrosis.
23954828 2013 Dok5 is involved in the signaling pathway of neurotrophin-3 against TrkC-induced apoptosis.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23733669 2013 Mapping the structural topology of IRS family cascades through computational biology.
23192668 2013 Genetic analysis of 16 NMR-lipoprotein fractions in humans, the GOLDN study.
22152676 2011 Shared and unique components of human population structure and genome-wide signals of positive selection in South Asia.
21472221 Insulin receptor substrates-5 and -6 are poor substrates for the insulin receptor.
21364910 2011 Exploring the evolutionary relationship of insulin receptor substrate family using computational biology.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20534969 2010 Integrative epigenomic and genomic analysis of malignant pheochromocytoma.
More...