Property Summary

NCBI Gene PubMed Count 22
PubMed Score 11.38
PubTator Score 16.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Synonym

Accession Q9P104 Q5T7Y0 Q5TE53 Q8TEW7 Q96H13 Q9BZ24 Q9NQF4 Q9Y411
Symbols IRS6
IRS-6
C20orf180

Gene

PDB

1J0W  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MASNFNDIVKQGYVRIRSRRLGIYQRCWLVFKKASSKGPKRLEKFSDERAAYFRCYHKVTELNNVKNVAR      1 - 70
LPKSTKKHAIGIYFNDDTSKTFACESDLEADEWCKVLQMECVGTRINDISLGEPDLLATGVEREQSERFN     71 - 140
VYLMPSPNLDVHGECALQITYEYICLWDVQNPRVKLISWPLSALRRYGRDTTWFTFEAGRMCETGEGLFI    141 - 210
FQTRDGEAIYQKVHSAALAIAEQHERLLQSVKNSMLQMKMSERAASLSTMVPLPRSAYWQHITRQHSTGQ    211 - 280
LYRLQDVSSPLKLHRTETFPAYRSEH                                                281 - 306
//

Text Mined References (23)

PMID Year Title