Property Summary

NCBI Gene PubMed Count 10
PubMed Score 160.43
PubTator Score 27.78

Knowledge Summary


No data available



  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.700 5.7e-04
atypical teratoid / rhabdoid tumor 2.300 3.4e-05
ependymoma 1.100 2.3e-04
glioblastoma 1.200 3.1e-02
nephrosclerosis -1.777 1.8e-02
ovarian cancer 1.800 5.0e-06
pituitary cancer 1.300 2.2e-03
sonic hedgehog group medulloblastoma -1.200 9.6e-04


Accession Q9P0Z9 B3KNH0 Q96H28 Q9C070 PSO
Symbols LPIPOX


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (6)

Gene RIF (1)

AA Sequence

FKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL                                  351 - 390

Text Mined References (12)

PMID Year Title