Property Summary

NCBI Gene PubMed Count 24
PubMed Score 10.82
PubTator Score 18.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.100 1.8e-02
astrocytic glioma -1.200 4.9e-02
chronic rhinosinusitis -1.173 3.6e-02
glioblastoma -1.300 7.0e-03
malignant mesothelioma -3.600 5.5e-08
medulloblastoma, large-cell -1.900 1.3e-04
osteosarcoma -1.581 1.7e-04
ovarian cancer -2.200 2.2e-11
psoriasis -1.400 6.0e-03

Gene RIF (9)

AA Sequence

MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDCSV      1 - 70
PVSVSTSIKYADQQRREKLKKELAQCEKEFKLTKTAMRANYKNNSKSLFNTLQKPSGEPQIEDDMLKEEM     71 - 140
NGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDYAASGPRKLSSGALYGRRPRSTFPNS    141 - 210
HRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFTDQRIEAETQTE    211 - 280
LSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSL    281 - 350
KPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLG    351 - 420
CTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTE    421 - 490
FFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLN    491 - 560
TSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV                                   561 - 599
//

Text Mined References (24)

PMID Year Title