Property Summary

NCBI Gene PubMed Count 21
PubMed Score 12.68
PubTator Score 11.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-05
astrocytic glioma 1.300 2.2e-02
atypical teratoid / rhabdoid tumor 1.800 2.3e-11
COPD -1.100 1.1e-03
Down syndrome 1.100 9.9e-04
ependymoma 1.800 1.8e-03
glioblastoma 1.300 3.5e-09
intraductal papillary-mucinous adenoma (... 1.100 8.0e-03
intraductal papillary-mucinous carcinoma... 1.900 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.200 2.9e-02
medulloblastoma 1.200 2.4e-04
Multiple myeloma 1.109 5.6e-03
oligodendroglioma 1.200 2.7e-11
osteosarcoma 1.553 2.2e-03
ovarian cancer 2.300 1.3e-05
primitive neuroectodermal tumor 1.100 1.1e-02
psoriasis 1.100 3.2e-04
subependymal giant cell astrocytoma 1.211 2.3e-02

Gene RIF (10)

AA Sequence

MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGP      1 - 70
KAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQS     71 - 140
EAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFTEEFLDQNKAREAELRRLRKMN    141 - 210
VAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTL    211 - 280
DFYMARLHGAIERDPAQHEKLIVRIKEILAQVASEHL                                     281 - 317
//

Text Mined References (24)

PMID Year Title