Property Summary

NCBI Gene PubMed Count 20
Grant Count 7
Funding $480,982.25
PubMed Score 12.28
PubTator Score 11.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25486196 Fresh insight into the mechanism by which the HMG20b-BRCA2 complex controls mitotic cell division, and implicate heterozygous HMG20b mutations affecting cytokinesis regulation in the genesis of human cancers.
22570500 HMG20B/BRAF35 forms heterodimers with HMG20A/iBRAF. Heterodimerization impairs HMG20B/BRAF35 sumoylation and interaction with the LSD1-CoREST complex.
21399666 a novel function for HMG20b in cytokinesis is regulated by its interaction with the BRC repeats of BRCA2
20530487 beta-dystrobrevin interacts with the HMG20 proteins iBRAF and BRAF35
17961134 we have examined Sox gene expression in 60 human primary gliomas. Transcripts from each of the six group E and group D genes were expressed in gliomas of various types and malignancy grades
12809554 Results demonstrating association of BRAF35 with KIF4 through the interaction of their respective alpha-helical coiled-coil domains is unique so far in mammals.
12083779 molecular Cloning of BRAF25, an alternatively spliced protein of BRAF35
12032298 complex containing histone deacetylase complex containing histone deacetylase mediates repression of neuronal-specific genes.
11997092 molecular cloning, nucleotide and amino acid sequencing

AA Sequence

MSHGPKQPGAAAAPAGGKAPGQHGGFVVTVKQERGEGPRAGEKGSHEEEPVKKRGWPKGKKRKKILPNGP      1 - 70
KAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPTEKQRYLDEAEREKQQYMKELRAYQQS     71 - 140
EAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVPIFTEEFLDQNKAREAELRRLRKMN    141 - 210
VAFEEQNAVLQRHTQSMSSARERLEQELALEERRTLALQQQLQAVRQALTASFASLPVPGTGETPTLGTL    211 - 280
DFYMARLHGAIERDPAQHEKLIVRIKEILAQVASEHL                                     281 - 317
//

Text Mined References (22)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25486196 2014 A cancer-associated mutation inactivates a region of the high-mobility group protein HMG20b essential for cytokinesis.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22570500 2012 Control of neuronal differentiation by sumoylation of BRAF35, a subunit of the LSD1-CoREST histone demethylase complex.
21399666 2011 A mitotic function for the high-mobility group protein HMG20b regulated by its interaction with the BRC repeats of the BRCA2 tumor suppressor.
20530487 2010 The interaction with HMG20a/b proteins suggests a potential role for beta-dystrobrevin in neuronal differentiation.
17961134 2007 Expression of SoxE and SoxD genes in human gliomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...