Property Summary

NCBI Gene PubMed Count 19
PubMed Score 20.57
PubTator Score 20.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
FTDALS1 4 3.853 1.9

Gene RIF (12)

AA Sequence

MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQ      1 - 70
EFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMK     71 - 140
EMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK       141 - 207
//

Text Mined References (19)

PMID Year Title