Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.48
PubTator Score 16.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.300 8.7e-03
Astrocytoma, Pilocytic 1.100 1.2e-03
atypical teratoid / rhabdoid tumor 1.800 2.0e-05
Breast cancer -1.100 3.1e-07
dermatomyositis 1.200 2.5e-03
Down syndrome 1.400 5.1e-04
ependymoma 1.800 2.1e-11
glioblastoma 1.600 3.9e-07
invasive ductal carcinoma -1.400 9.2e-03
lung adenocarcinoma -1.900 1.3e-10
lung carcinoma -1.100 6.1e-13
medulloblastoma 1.400 1.9e-02
medulloblastoma, large-cell 1.200 1.2e-02
mucosa-associated lymphoid tissue lympho... 2.000 2.9e-02
Multiple myeloma 2.450 8.5e-05
osteosarcoma 1.021 4.6e-02
ovarian cancer -2.100 4.2e-06
primitive neuroectodermal tumor 2.000 3.2e-06
pulmonary arterial hypertension -4.100 3.6e-02
spina bifida -1.058 4.2e-02
tuberculosis -1.400 3.2e-03

Gene RIF (3)

AA Sequence

MASSEVARHLLFQSHMATKTTCMSSQGSDDEQIKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNIL      1 - 70
CVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQ     71 - 140
PIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKA    141 - 210
DTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGNKMVKARQY    211 - 280
PWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEA    281 - 350
KRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAF    351 - 420
SKKKATSEIFHSQSFLATGSNLRKDKDRKNSNFL                                        421 - 454
//

Text Mined References (14)

PMID Year Title