Property Summary

NCBI Gene PubMed Count 59
Grant Count 24
R01 Count 11
Funding $2,226,747.31
PubMed Score 87.65
PubTator Score 73.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.814 0.000
group 3 medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.800 0.000
glioblastoma 1.800 0.000
medulloblastoma, large-cell 2.200 0.000
primitive neuroectodermal tumor 1.200 0.000
pediatric high grade glioma 1.300 0.000

Gene RIF (44)

PMID Text
26852650 Genetic interactions of SNPs in CARD14, SENP1 and VEGFA might represent a functional mechanism in the pathogenesis of high altitude polycythemia.
26548925 SENP1 desensitizes hypoxic ovarian cancer cells to cisplatin by up-regulating HIF-1alpha
26389676 SENP1 was expressed in human islets, and its mRNA level was unchanged in islets from donors with T2D. In cultured islets, overexpressed SENP1-GFP colocalized with secretory granules at the plasma membrane
26202067 SENP1 expression has strong prognostic impact in a molecularly defined subset of cancers. This is per se not surprising as the biologic impact of each individual molecular event is likely to be dependent on its cellular environment.
25791478 results delineate a key role for Senp1in IL-6 induced proliferation and survival of MM cells, suggesting it may be a potential new therapeutic target in MM
25645686 low expression of miR-145 was correlated with high expression of SENP1 in Prostate cancer cell line and the SENP1 3'-untranslated region was a regulative target of miR-145 in vitro.
25446185 SENP1 up-regulation in diseased heart is mediated via calcineurin-NFAT/MEF2C-PGC-1alpha pathway.
25430449 Over-expression of small ubiquitin-like modifier proteases 1 predicts chemo-sensitivity and poor survival in non-small cell lung cancer.(
25263960 SENP1 uses remote substrate binding for conformational flexibility and activation
25225945 results provide independent evidence in support of a role for SENP1 in chronic mountain sickness in individuals of Quechua ancestry and suggest the SENP1 and ANP32D signatures of selection are in tight linkage disequilibrium (LD).
More...

AA Sequence

MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPS      1 - 70
YYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHH     71 - 140
CHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAK    141 - 210
PTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVA    211 - 280
FGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYD    281 - 350
SRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEF    351 - 420
PEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSV    421 - 490
HAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEAC    491 - 560
RILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYF    561 - 630
RKRMVWEILHRKLL                                                            631 - 644
//

Text Mined References (67)

PMID Year Title
26852650 2016 Interaction of CARD14, SENP1 and VEGFA polymorphisms on susceptibility to high altitude polycythemia in the Han Chinese population at the Qinghai-Tibetan Plateau.
26548925 2015 SENP1 desensitizes hypoxic ovarian cancer cells to cisplatin by up-regulating HIF-1?.
26389676 2015 Isocitrate-to-SENP1 signaling amplifies insulin secretion and rescues dysfunctional ? cells.
26202067 2015 The prognostic value of SUMO1/Sentrin specific peptidase 1 (SENP1) in prostate cancer is limited to ERG-fusion positive tumors lacking PTEN deletion.
25791478 2015 SENP1 inhibition induces apoptosis and growth arrest of multiple myeloma cells through modulation of NF-?B signaling.
25645686 2015 Tumor-suppressive microRNA-145 induces growth arrest by targeting SENP1 in human prostate cancer cells.
25446185 2015 Induction of SENP1 in myocardium contributes to abnormities of mitochondria and cardiomyopathy.
25430449 2014 Over-expression of small ubiquitin-like modifier proteases 1 predicts chemo-sensitivity and poor survival in non-small cell lung cancer.
25406032 2014 Modification of DBC1 by SUMO2/3 is crucial for p53-mediated apoptosis in response to DNA damage.
25263960 2014 Conformational flexibility and changes underlying activation of the SUMO-specific protease SENP1 by remote substrate binding.
More...